Property Summary

NCBI Gene PubMed Count 4
Grant Count 5
R01 Count 5
Funding $312,296
PubMed Score 1.49
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 0.019
ependymoma -1.400 0.033
oligodendroglioma -1.200 0.034
osteosarcoma -1.149 0.014
medulloblastoma, large-cell -1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.294 0.003
intraductal papillary-mucinous adenoma (... 1.100 0.002
spina bifida -1.424 0.045
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.100 0.008
invasive ductal carcinoma -1.500 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q4W4Y0
Symbols DRIP1
DRIP-1
c14_5270

Gene

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20874815 our data suggest: (i) C14ORF28, GNB2L1, MLLT3, DRD2 and DARPP-32 are important in the pathogenesis of schizophrenia and bipolar disorder

AA Sequence

MKTLFEEIKASIKNNYNQDRSFCRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTIDGFLMLLYVIL      1 - 70
NENENFPRELSLHFGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFT     71 - 140
KNLENLMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLR    141 - 210
EFSQRIFCHGAPPFVVLNMQHWKSEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYSAAFQIGGHWMHYD    211 - 280
GLRNVNLILLNKPPEFLLLSSLVYIRATEK                                            281 - 310
//

Text Mined References (4)

PMID Year Title
20874815 2011 Altered expression and coregulation of dopamine signalling genes in schizophrenia and bipolar disorder.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.