Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.21
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 1.9e-02
Breast cancer -1.200 4.8e-10
ductal carcinoma in situ -1.100 7.8e-03
ependymoma -1.400 3.3e-02
intraductal papillary-mucinous adenoma (... 1.100 2.1e-03
invasive ductal carcinoma -1.500 4.8e-04
medulloblastoma, large-cell -1.300 1.3e-03
oligodendroglioma -1.200 3.4e-02
osteosarcoma -1.149 1.4e-02
ovarian cancer -1.200 2.5e-07
pancreatic ductal adenocarcinoma liver m... -1.294 2.9e-03
spina bifida -1.424 4.5e-02

Gene RIF (1)

AA Sequence

MKTLFEEIKASIKNNYNQDRSFCRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTIDGFLMLLYVIL      1 - 70
NENENFPRELSLHFGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFT     71 - 140
KNLENLMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLR    141 - 210
EFSQRIFCHGAPPFVVLNMQHWKSEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYSAAFQIGGHWMHYD    211 - 280
GLRNVNLILLNKPPEFLLLSSLVYIRATEK                                            281 - 310
//

Text Mined References (5)

PMID Year Title