Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.49
PubTator Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 4.84516132125279E-10
ovarian cancer 8492 2.54210814326792E-7
invasive ductal carcinoma 2950 4.82900953971539E-4
medulloblastoma, large-cell 6234 0.00126829637763474
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00209621194087814
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00290189814381584
ductal carcinoma in situ 1745 0.00783825123705714
osteosarcoma 7933 0.013618000032325
astrocytic glioma 2241 0.0191489471799876
ependymoma 2514 0.0328459514486486
oligodendroglioma 2849 0.0337140817337908
spina bifida 1064 0.045046261339187

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 0.019
ependymoma -1.400 0.033
oligodendroglioma -1.200 0.034
osteosarcoma -1.149 0.014
medulloblastoma, large-cell -1.300 0.001
pancreatic ductal adenocarcinoma liver m... -1.294 0.003
intraductal papillary-mucinous adenoma (... 1.100 0.002
spina bifida -1.424 0.045
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.100 0.008
invasive ductal carcinoma -1.500 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q4W4Y0
Symbols DRIP1
DRIP-1
c14_5270

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
20874815 our data suggest: (i) C14ORF28, GNB2L1, MLLT3, DRD2 and DARPP-32 are important in the pathogenesis of schizophrenia and bipolar disorder

AA Sequence

MKTLFEEIKASIKNNYNQDRSFCRPVLPWGGVFTIKAGRKAVSCTPLYVEIRLKNTCTIDGFLMLLYVIL      1 - 70
NENENFPRELSLHFGREFVDCFLYLMDTYSFTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFT     71 - 140
KNLENLMSTIQESYCSNWRCPTRVQEDQQRTININPPQEIPHGNLIRLAVNELFCSKIELCEEHGCGGLR    141 - 210
EFSQRIFCHGAPPFVVLNMQHWKSEDLAYVPYYLDLSDHKYLLEGATLFNKEEHHYSAAFQIGGHWMHYD    211 - 280
GLRNVNLILLNKPPEFLLLSSLVYIRATEK                                            281 - 310
//

Text Mined References (4)

PMID Year Title
20874815 2011 Altered expression and coregulation of dopamine signalling genes in schizophrenia and bipolar disorder.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.