Property Summary

NCBI Gene PubMed Count 11
Grant Count 10
R01 Count 5
Funding $2,065,602.5
PubMed Score 16.66
PubTator Score 6.41

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that PABPC1L gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with PABPC1L
24968937 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that PABPC1L gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with PABPC1L
18716053 Human EPAB mRNA is detected in ovaries, testes and several somatic tissues including pancreas, liver and thymus, and EPAB is the predominant poly(A) binding protein in immature (germinal vesicle) and mature (metaphase II) oocytes.

AA Sequence

MNASGSGYPLASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDVATRRSLGYAYINFQQPADAERALD      1 - 70
TMNFEMLKGQPIRIMWSQRDPGLRKSGVGNIFIKNLEDSIDNKALYDTFSTFGNILSCKVACDEHGSRGF     71 - 140
GFVHFETHEAAQQAINTMNGMLLNDRKVFVGHFKSRREREAELGARALEFTNIYVKNLPVDVDEQGLQDL    141 - 210
FSQFGKMLSVKVMRDNSGHSRCFGFVNFEKHEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELKRRF    211 - 280
EQMKQDRLRRYQGVNLYVKNLDDSIDDDKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAV    281 - 350
TEMNGRIVGTKPLYVALAQRKEERKAILTNQYMQRLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAY    351 - 420
YGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTG    421 - 490
PSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEPLTASMLAAAPLHEQKQMIGERLYPLIHDVH    491 - 560
TQLAGKITGMLLEIDNSELLLMLESPESLHAKIDEAVAVLQAHQAMEQPKAYMH                    561 - 614
//

Text Mined References (11)

PMID Year Title
24002949 2014 Human embryonic poly(A)-binding protein (EPAB) alternative splicing is differentially regulated in human oocytes and embryos.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18716053 2008 Identification and characterization of human embryonic poly(A) binding protein (EPAB).
18483763 2008 Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
More...