Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.26
PubTator Score 0.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.400 1.3e-04
osteosarcoma -1.617 1.8e-05
pituitary cancer 1.100 2.1e-04
subependymal giant cell astrocytoma -1.241 5.0e-02

AA Sequence

MLSAFQRLFRVLFVIETVSEYGVLIFIYGWPFLQTLAMLLIGTVSFHLWIRRNRERNSRSGKTRCRSKRS      1 - 70
EQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGDTYLRCIEVHSHTLIQLESWFTATGQT     71 - 140
RVTVVGPHRARQWLLHMFCCVGSQDSYHHARGLEMLERVRSQPLTNDDLVTSISVPPYTGDLSLAPRISG    141 - 210
TVCLSVPQPSPYQVIGCSGFHLSSLYP                                               211 - 237
//

Text Mined References (7)

PMID Year Title