Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.26
PubTator Score 0.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.81604201559356E-5
medulloblastoma, large-cell 6234 1.34096528645061E-4
pituitary cancer 1972 2.1271953166215E-4
subependymal giant cell astrocytoma 2287 0.0499500783125333
Disease Target Count Z-score Confidence
Actinic keratosis 22 3.644 1.8
Moyamoya disease 9 3.516 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.617 0.000
medulloblastoma, large-cell -1.400 0.000
subependymal giant cell astrocytoma -1.241 0.050
pituitary cancer 1.100 0.000

Synonym

Accession Q4VXA5 Q5JSQ7 Q8WTV2 Q96NQ5
Symbols NDG1
C6orf147
C6orf148
bA257K9.4
Em:AC019205.8

Gene

AA Sequence

MLSAFQRLFRVLFVIETVSEYGVLIFIYGWPFLQTLAMLLIGTVSFHLWIRRNRERNSRSGKTRCRSKRS      1 - 70
EQSMDMGTSALSKKPWWTLPQNFHAPMVFHMEEDQEELIFGHGDTYLRCIEVHSHTLIQLESWFTATGQT     71 - 140
RVTVVGPHRARQWLLHMFCCVGSQDSYHHARGLEMLERVRSQPLTNDDLVTSISVPPYTGDLSLAPRISG    141 - 210
TVCLSVPQPSPYQVIGCSGFHLSSLYP                                               211 - 237
//

Text Mined References (7)

PMID Year Title
17913455 2007 Atypical structure and phylogenomic evolution of the new eutherian oocyte- and embryo-expressed KHDC1/DPPA5/ECAT1/OOEP gene family.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.