Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.88
PubTator Score 2.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.300 8.4e-03
atypical teratoid / rhabdoid tumor -1.600 8.9e-03
Breast cancer -1.700 2.9e-04
glioblastoma -1.800 2.1e-03
group 3 medulloblastoma -1.600 2.6e-05
intraductal papillary-mucinous adenoma (... 1.400 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.700 9.1e-03
lung adenocarcinoma -1.700 2.4e-06
lung carcinoma -2.200 2.3e-16
medulloblastoma, large-cell -1.200 2.4e-04
nasopharyngeal carcinoma -1.300 1.1e-03
non-small cell lung cancer -1.386 4.3e-10
osteosarcoma -1.297 1.6e-06
pediatric high grade glioma -1.800 3.2e-04
primitive neuroectodermal tumor -1.600 2.3e-03
psoriasis 1.100 1.6e-05
spina bifida -1.638 3.7e-02

Gene RIF (1)

AA Sequence

MGHFEKGQHALLNEGEENEMEIFGYRTQGCRKSLCLAGSIFSFGILPLVFYWRPAWHVWAHCVPCSLQEA      1 - 70
DTVLLRTTDEFQIYSWKKVIWIYLSALNSAFGLTPDHPLMTDEEYIINRAIRKPDLKVRCIKVQKIRYVW     71 - 140
NYLEGQFQKIGSLEDWLSSAKIHQKFGSGLTREEQEIRRLICGPNTIDVEVTPIWKLLIKEVLNPFYIFQ    141 - 210
LFSVCLWFSEDYKEYAFAIIIMSIISISLTVYDLREQSVKLHHLVESHNSITVSVCGRKAGVQELESRVL    211 - 280
VPGDLLILTGNKVLMPCDAVLIEGSCVVDEGMLTGESIPVTKTPLPKMDSSVPWKTQSEADYKRHVLFCG    281 - 350
TEVIQAKAACSGTVRAVVLQTGFNTAKGDLVRSILYPKPVNFQLYRDAIRFLLCLVGTATIGMIYTLCVY    351 - 420
VLSGEPPEEVVRKALDVITIAVPPALPAALTTGIIYAQRRLKKRGIFCISPQRINVCGQLNLVCFDKTGT    421 - 490
LTRDGLDLWGVVSCDRNGFQEVHSFASGQALPWGPLCAAMASCHSLILLDGTIQGDPLDLKMFEATTWEM    491 - 560
AFSGDDFHIKGVPAHAMVVKPCRTASQVPVEGIAILHQFPFSSALQRMTVIVQEMGGDRLAFMKGAPERV    561 - 630
ASFCQPETVPTSFVSELQIYTTQGFRVIALAYKKLENDHHATTLTRETVESDLIFLGLLILENRLKEETK    631 - 700
PVLEELISARIRTVMITGDNLQTAITVARKSGMVSESQKVILIEANETTGSSSASISWTLVEEKKHIMYG    701 - 770
NQDNYINIRDEVSDKGREGSYHFALTGKSFHVISQHFSSLLPKILINGTIFARMSPGQKSSLVEEFQKLD    771 - 840
YFVGMCGDGANDCGALKMAHVGISLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVTSFCMFKYMALY    841 - 910
SMIQYVGVLLLYWETNSLSNYQFLFQDLAITTLIGVTMNLNGAYPKLVPFRPAGRLISPPLLLSVIFNIL    911 - 980
LSLAMHIAGFILVQRQPWYSVEIHSACTVQNESISELTMSPTAPEKMESNSTFTSFENTTVWFLGTINCI    981 - 1050
TVALVFSKGKPFRQPTYTNYIFVLVLIIQLGVCLFILFADIPELYRRLDLLCTPVLWRASIVIMLSLNFI   1051 - 1120
VSLVAEEAVIENRALWMMIKRCFGYQSKSQYRIWQRDLANDPSWPPLNQTSHSDMPECGRGVSYSNPVFE   1121 - 1190
SNEEQL                                                                   1191 - 1196
//

Text Mined References (7)

PMID Year Title