Property Summary

NCBI Gene PubMed Count 5
PubMed Score 12.75
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.01251670939906E-15
osteosarcoma 7933 1.019668266747E-5
gastric cancer 436 1.31399570359966E-4
Duchenne muscular dystrophy 602 0.00125788972709537
Amyotrophic Lateral Sclerosis 432 0.00151134569244634
medulloblastoma, large-cell 6234 0.00233975822272553
pituitary cancer 1972 0.0326281218276841
diabetes mellitus 1663 0.0331917755965287

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer 1.200 0.000
osteosarcoma -2.954 0.000
medulloblastoma, large-cell -1.100 0.002
Duchenne muscular dystrophy -1.176 0.001
Amyotrophic Lateral Sclerosis 1.061 0.002
diabetes mellitus -1.500 0.033
lung carcinoma 1.300 0.000
pituitary cancer 1.200 0.033

Synonym

Accession Q4VC12 A6NGH6 Q2VP95 Q5F2H5 Q7Z3M9 Q8N8G0
Symbols ZMYND17

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (2)

PMID Text
21531385 ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes are potential candidate genes for schizophrenia, especially in patients with deficits in sustained attention and executive function.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQLILQKLNMKSY      1 - 70
EEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKS     71 - 140
DWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWPPEAVQDWDSWFSMKGLHLDATLDAVLVSHA    141 - 210
VTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRP    211 - 280
GDYDELGYMFPGHLGLRVVMVGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDL    281 - 350
VAAFHPGFHSSPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAFGSNPFMSLKPE    351 - 420
QVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI                                  421 - 460
//

Text Mined References (10)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21531385 2011 ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes at chromosome 10q22 associated with the subgroup of schizophrenia with deficits in attention and executive function.
19710419 2009 Dual functions of Mss51 couple synthesis of Cox1 to assembly of cytochrome c oxidase in Saccharomyces cerevisiae mitochondria.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.