Property Summary

NCBI Gene PubMed Count 5
PubMed Score 13.17
PubTator Score 2.23

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.061 1.5e-03
diabetes mellitus -1.500 3.3e-02
Duchenne muscular dystrophy -1.176 1.3e-03
gastric cancer 1.200 1.3e-04
lung carcinoma 1.300 2.0e-15
medulloblastoma, large-cell -1.100 2.3e-03
osteosarcoma -2.954 1.0e-05
pituitary cancer 1.200 3.3e-02

Gene RIF (2)

AA Sequence

MAPRSRRRRHKKPPSSVAPIIMAPTTIVTPVPLTPSKPGPSIDTLGFFSLDDNVPGLSQLILQKLNMKSY      1 - 70
EEYKLVVDGGTPVSGFGFRCPQEMFQRMEDTFRFCAHCRALPSGLSDSKVLRHCKRCRNVYYCGPECQKS     71 - 140
DWPAHRRVCQELRLVAVDRLMEWLLVTGDFVLPSGPWPWPPEAVQDWDSWFSMKGLHLDATLDAVLVSHA    141 - 210
VTTLWASVGRPRPDPDVLQGSLKRLLTDVLSRPLTLGLGLRALGIDVRRTGGSTVHVVGASHVETFLTRP    211 - 280
GDYDELGYMFPGHLGLRVVMVGVDVATGFSQSTSTSPLEPGTIQLSAHRGLYHDFWEEQVETGQTHHPDL    281 - 350
VAAFHPGFHSSPDLMEAWLPTLLLLRDYKIPTLITVYSHQELVSSLQILVELDTHITAFGSNPFMSLKPE    351 - 420
QVYSSPNKQPVYCSAYYIMFLGSSCQLDNRQLEEKVDGGI                                  421 - 460
//

Text Mined References (10)

PMID Year Title