Property Summary

NCBI Gene PubMed Count 15
PubMed Score 10.28
PubTator Score 11.36

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.200 1.2e-02
ependymoma -1.100 4.5e-07
Gaucher disease type 1 1.100 1.2e-02
lung cancer 1.600 2.6e-03
malignant mesothelioma 1.100 1.9e-05
osteosarcoma -1.177 6.7e-04
psoriasis -1.800 4.5e-05
sonic hedgehog group medulloblastoma 1.400 1.1e-07
subependymal giant cell astrocytoma -1.878 5.4e-03

Gene RIF (9)

AA Sequence

MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEK      1 - 70
CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGK     71 - 140
EHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM    141 - 210
//

Text Mined References (22)

PMID Year Title