Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.45
PubTator Score 11.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.900 0.000
osteosarcoma -1.177 0.001
posterior fossa group B ependymoma -1.200 0.000
lung cancer 1.800 0.002
sonic hedgehog group medulloblastoma 1.400 0.000
subependymal giant cell astrocytoma -1.878 0.005
acute myeloid leukemia 1.200 0.012
Gaucher disease type 3 1.200 0.005

Gene RIF (8)

PMID Text
23043359 Report describes BCL7A protein expression in normal lymphoid tissues and lymphomas using immunohistochemistry.
22856870 Data suggest that BCL7A may play an important role in cutaneous T-cell lymphoma (CTCL) carcinogenesis.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19336552 Variants in BCL7A were strongly related to diffuse large B-cell lymphoma.
19336552 Observational study of gene-disease association. (HuGE Navigator)
18663754 deletion of genes BCL7A in early-stage mycosis fungoides.
15897551 Promoter hypermethylation of BCL7a is associated with cutaneous T-cell lymphoma

AA Sequence

MSGRSVRAETRSRAKDDIKRVMAAIEKVRKWEKKWVTVGDTSLRIYKWVPVTEPKVDDKNKNKKKGKDEK      1 - 70
CGSEVTTPENSSSPGMMDMHDDNSNQSSIADASPIKQENSSNSSPAPEPNSAVPSDGTEAKVDEAQADGK     71 - 140
EHPGAEDASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQDLEGVPPSKKMKLEASQQNSEEM    141 - 210
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043359 2013 BCL7A protein expression in normal and malignant lymphoid tissues.
22856870 2013 Loss of BCL7A expression correlates with poor disease prognosis in patients with early-stage cutaneous T-cell lymphoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
More...