Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.84
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MVSAAAPSLLILLLLLLGSVPATDARSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQ      1 - 70
PITLGGPSPPTNFLDGIVDFFRQYVMLIAVVGSLAFLLMFIVCAAVITRQKQKASAYYPSSFPKKKYVDQ     71 - 140
SDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEK    141 - 210
GSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVH    211 - 280
PSV                                                                       281 - 283
//

Text Mined References (10)

PMID Year Title