Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
Funding $239,122
PubMed Score 6.92
PubTator Score 1.90

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q4V9L6 Q6UXE5 Q8N2F5
Symbols OBIF

Gene

 Grant Application (1)

Gene RIF (2)

PMID Text
26884166 qPCR showed that TMEM119 expression was highly enriched in temporal lobe CD11b+ cells over unpurified whole brain, and barely detectable in peripheral blood leukocytes.
26250788 TMEM119 serves as a reliable microglial marker that discriminates resident microglia from blood-derived macrophages in the human brain

AA Sequence

MVSAAAPSLLILLLLLLGSVPATDARSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQ      1 - 70
PITLGGPSPPTNFLDGIVDFFRQYVMLIAVVGSLAFLLMFIVCAAVITRQKQKASAYYPSSFPKKKYVDQ     71 - 140
SDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEK    141 - 210
GSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVH    211 - 280
PSV                                                                       281 - 283
//

Text Mined References (10)

PMID Year Title
26884166 2016 New tools for studying microglia in the mouse and human CNS.
26250788 2016 TMEM119 marks a subset of microglia in the human brain.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20025746 2009 Isolation and characterization of a novel plasma membrane protein, osteoblast induction factor (obif), associated with osteoblast differentiation.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.