Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Ankylosis 28 4.042 2.0

AA Sequence

MMNLEKNFDKTTLFNHMRTDKRGKCSDLNEYGTSCDKTTAVEYNKVHMAMTHYECNERGINFSRKSPLTQ      1 - 70
SQRTITGWSAFESNKCEENFSQSSAHIVHQKTQAGDKFGEHNECTDALYQKLDFTAHQRIHTDFTAHQKF     71 - 140
YLSDEHGKCRKSFYWKAHLIQHERPHSGEKTYQYEECAKSFCSSSHPIQHPGTYVGFKLYECNECGKAFC    141 - 210
QNSNLSKHLRIHTKEKPCDNNGCGRSYKSPLIGHQKTDAEMELCGGSEYGKTSHLKGHQRILMGEKPYEC    211 - 280
IECGKTFSKTSHLRAHQRIHTGEKPYECVECEKTFSHKTHLSVHQRVHTGEKPYECNDCGKSFTYNSALR    281 - 350
AHQRIHTGEKPYECSDCEKTFAHNSALRAHHRIHTGEKPYECNECGRSFAHISVLKAHQRIHTREKPYEC    351 - 420
NECGRSFTYNSALRAHQRIHTGRKPYECSDCEKTFAHNSALKIHQRIHTGEKPYKCNECEKTFAHNSALR    421 - 490
AHQNIHTGEKLYECSECGKTFFQKTRLSTHRRIHTGEKPYECSKCGKTFSQKSYLSGHERIHTGEKPYEC    491 - 560
NVCGKTFVYKAALIVHQRIHTGEKPYECNECGKTFSQRTHLCAHQRIHTGEKPYECNECGKTFADNSALR    561 - 630
AHHRIHTGEKPYECNDCGKTFSKTSHLRAHLRTRSGEKPYECSECGKTFSEKSYVSAHQRVHTGEKPYEC    631 - 700
NVCGKPFAHNSTLRVHQRIHTGEKSYECNDCGKTFSQKSHLSAHQRIHTGEKPYECNECGKAFAQNSTLR    701 - 770
VHQRIHTGEKPYECDECGKTFVRKAALRVHHTRMHTREKTLACNGFGKS                         771 - 819
//

Text Mined References (6)

PMID Year Title