Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.63
PubTator Score 7.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 9.6e-05
atypical teratoid / rhabdoid tumor -1.500 9.0e-08
glioblastoma -1.300 6.9e-06
medulloblastoma, large-cell -1.400 2.4e-05
osteosarcoma -1.935 3.2e-07
posterior fossa group A ependymoma -1.100 1.3e-07

Gene RIF (3)

AA Sequence

MAQALSEEEFQRMQAQLLELRTNNYQLSDELRKNGVELTSLRQKVAYLDKEFSKAQKALSKSKKAQEVEV      1 - 70
LLSENEMLQAKLHSQEEDFRLQNSTLMAEFSKLCSQMEQLEQENQQLKEGAAGAGVAQAGPLVDGELLRL     71 - 140
QAENTALQKNVAALQERYGKEAGKFSAVSEGQGDPPGGPAPTVLAPMPLAEVELKWEMEKEEKRLLWEQL    141 - 210
QGLESSKQAETSRLQEELAKLSEKLKKKQESFCRLQTEKETLFNDSRNKIEELQQRKEADHKAQLARTQK    211 - 280
LQQELEAANQSLAELRDQRQGERLEHAAALRALQDQVSIQSADAQEQVEGLLAENNALRTSLAALEQIQT    281 - 350
AKTQELNMLREQTTGLAAELQQQQAEYEDLMGQKDDLNSQLQESLRANSRLLEQLQEIGQEKEQLTQELQ    351 - 420
EARKSAEKRKAMLDELAMETLQEKSQHKEELGAVRLRHEKEVLGVRARYERELRELHEDKKRQEEELRGQ    421 - 490
IREEKARTRELETLQQTVEELQAQVHSMDGAKGWFERRLKEAEESLQQQQQEQEEALKQCREQHAAELKG    491 - 560
KEEELQDVRDQLEQAQEERDCHLKTISSLKQEVKDTVDGQRILEKKGSAALKDLKRQLHLERKRADKLQE    561 - 630
RLQDILTNSKSRSGLEELVLSEMNSPSRTQTGDSSSISSFSYREILREKESSAVPARSLSSSPQAQPPRP    631 - 700
AELSDEEVAELFQRLAETQQEKWMLEEKVKHLEVSSASMAEDLCRKSAIIETYVMDSRIDVSVAAGHTDR    701 - 770
SGLGSVLRDLVKPGDENLREMNKKLQNMLEEQLTKNMHLHKDMEVLSQEIVRLSKECVGPPDPDLEPGET    771 - 840
S//

Text Mined References (28)

PMID Year Title