Property Summary

NCBI Gene PubMed Count 61
Grant Count 86
R01 Count 70
Funding $7,145,411.7
PubMed Score 196.43
PubTator Score 185.47

Knowledge Summary

Patent

No data available

Synonym

Accession Q4U2R8 A8MY93 B2D0R6 O95187 O95742 Q7LDA0 Q8N192 Q9NQA6 Q9NQC2 Q9UBG6 Q9UEQ8
Symbols OAT1
PAHT
HOAT1
ROAT1

Gene

Gene RIF (46)

PMID Text
25354943 OAT1 and NaDC3 in the basolateral membrane and OAT4 in the luminal membrane of proximal tubule cells are responsible for the avid renal secretion of N-carbamoylglutamate.
25234312 BCL6 constitutes a promising candidate gene for the regulation of human OAT1 transcription
24530383 Clopidogrel/clopidogrel carboxylate are weak inhibitors of OAT1.
24185403 high capacity p-cresyl sulfate trasnporter
23832370 transport of xanthurenic acid by OAT1 and OAT3
23640180 PKC isoform PKCalpha was responsible for OAT1 ubiquitination.
23630107 The results confirmed that OAT1, OAT3, OCT2, MATE1, and MATE2-K were coexpressed in tubular epithelial cells.
23255614 It was shown that human OAT3 and OAT1 cannot be involved in the renal extraction of glutathione from blood, but OAT1 could support intracellular glutathione synthesis by taking up cysteinyl glycine.
22108572 Both hOAT1 and hOAT3 markedly stimulated the uptake of kynurenic acid into oocytes.
21945944 High urine OAT1 and OAT3 and low OAT4 is associated with early reversible proximal tubular damage.
More...

AA Sequence

MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKNGGLEVWLPRD      1 - 70
RQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTIVTEWDLVCSHRALRQLAQSL     71 - 140
YMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAAFAPNFPIYCAFRLLSGMALAGISLNCMTLN    141 - 210
VEWMPIHTRACVGTLIGYVYSLGQFLLAGVAYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGR    211 - 280
LDLTLRALQRVARINGKREEGAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATS    281 - 350
FAYYGLVMDLQGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS    351 - 420
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIY    421 - 490
GAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQEHQKYMVPLQASAQEK    491 - 560
NGL                                                                       561 - 563
//

Text Mined References (67)

PMID Year Title
25354943 2014 Transporters involved in renal excretion of N-carbamoylglutamate, an orphan drug to treat inborn n-acetylglutamate synthase deficiency.
25234312 2014 Transcriptional regulation of human organic anion transporter 1 by B-cell CLL/lymphoma 6.
24530383 2014 In vitro interaction of clopidogrel and its hydrolysate with OCT1, OCT2 and OAT1.
24185403 2014 Human organic anion transporters function as a high-capacity transporter for p-cresyl sulfate, a uremic toxin.
23832370 2013 Transport of xanthurenic acid by rat/human organic anion transporters OAT1 and OAT3.
23640180 2013 Three ubiquitination sites of organic anion transporter-1 synergistically mediate protein kinase C-dependent endocytosis of the transporter.
23630107 2013 Precise comparison of protein localization among OCT, OAT, and MATE in human kidney.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23255614 2013 Human organic anion transporter OAT1 is not responsible for glutathione transport but mediates transport of glutamate derivatives.
22169006 2012 Liver X receptor activation downregulates organic anion transporter 1 (OAT1) in the renal proximal tubule.
More...