Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.57

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP          1 - 66
//

Text Mined References (3)

PMID Year Title