Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.57

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16033865 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP          1 - 66
//

Text Mined References (3)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.