Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Gene RIF (1)

PMID Text
16033865 The protein encoded by this gene is thought to display antimicrobial activity.

AA Sequence

MKPLLVVFVFLFLWDPVLAGINSLSSEMHKKCYKNGICRLECYESEMLVAYCMFQLECCVKGNPAP          1 - 66
//

Text Mined References (3)

PMID Year Title
16033865 2005 Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.