Property Summary

NCBI Gene PubMed Count 2
PubMed Score 17.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Synonym

Accession Q4LEZ3 A5PKU8
Symbols C8orf85

Gene

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLRRRLTRAFQWA      1 - 70
VQRAISRRVQEAAAAAAAREEQSWTGVEATLARLRAELVEMHFQNHQLARTLLDLNMKVQQLKKEYELEI     71 - 140
TSDSQSPKDDAANPE                                                           141 - 155
//

Text Mined References (3)

PMID Year Title
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.