Property Summary

NCBI Gene PubMed Count 3
PubMed Score 18.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.0e-17
Disease Target Count Z-score Confidence
Childhood type dermatomyositis 3 3.319 1.7
Localized scleroderma 9 3.248 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 9.0e-17

Gene RIF (1)

AA Sequence

MGPGDFRRCRERISQGLQGLPGRAELWFPPRPACDFFGDGRSTDIQEEALAASPLLEDLRRRLTRAFQWA      1 - 70
VQRAISRRVQEAAAAAAAREEQSWTGVEATLARLRAELVEMHFQNHQLARTLLDLNMKVQQLKKEYELEI     71 - 140
TSDSQSPKDDAANPE                                                           141 - 155
//

Text Mined References (4)

PMID Year Title