Property Summary

NCBI Gene PubMed Count 7
PubMed Score 15.33
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.900 8.2e-04
astrocytic glioma -2.500 2.3e-03
Astrocytoma, Pilocytic -3.200 4.0e-07
atypical teratoid / rhabdoid tumor -3.400 8.3e-06
ependymoma -2.800 2.2e-03
glioblastoma -2.800 1.0e-07
group 3 medulloblastoma -3.000 7.6e-03
medulloblastoma, large-cell -3.600 1.0e-03
oligodendroglioma -2.400 7.0e-03
ovarian cancer -1.100 4.4e-08
pituitary cancer -2.600 2.0e-06
primitive neuroectodermal tumor -2.300 3.0e-02
psoriasis 2.700 1.7e-20

Gene RIF (4)

AA Sequence

MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEG      1 - 70
LEKGQFDHALA                                                                71 - 81
//

Text Mined References (8)

PMID Year Title