Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $216,700
PubMed Score 15.09
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -2.500 0.002
ependymoma -3.200 0.000
oligodendroglioma -2.400 0.007
glioblastoma -3.300 0.000
medulloblastoma -3.600 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -3.600 0.001
primitive neuroectodermal tumor -2.300 0.030
adult high grade glioma -2.900 0.001
pilocytic astrocytoma -3.200 0.000
ovarian cancer -1.100 0.000
pituitary cancer -2.600 0.000
psoriasis 2.700 0.000

Gene RIF (4)

PMID Text
25889058 altered expression of cortexin 3, either alone, or in parallel with changes in disrupted-in-schizophrenia 1, could subtly perturb GABAergic neurotransmission
22643131 Two single nucleotide polymophisms of the CTXN3 and SLC12A2 genes are associated with risk of schizophrenia in a Thai population.
19023125 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17786280 Selective expression of CTXN3 in the kidney and brain, the amino acid identity to cortexin, and its high conservation among different species indicate that CTXN3 may be involved in a process specifically restricted to kidney and brain tissue function.

AA Sequence

MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEG      1 - 70
LEKGQFDHALA                                                                71 - 81
//

Text Mined References (8)

PMID Year Title
25889058 2015 Association between 5q23.2-located polymorphism of CTXN3 gene (Cortexin 3) and schizophrenia in European-Caucasian males; implications for the aetiology of schizophrenia.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
22643131 2012 Association of CTXN3-SLC12A2 polymorphisms and schizophrenia in a Thai population.
19023125 2009 A genome-wide association study of schizophrenia using brain activation as a quantitative phenotype.
17786280 2007 In silico-initiated cloning and molecular characterization of cortexin 3, a novel human gene specifically expressed in the kidney and brain, and well conserved in vertebrates.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.