Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 3.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.101 2.5e-02
ependymoma 1.200 6.5e-05
Pick disease 1.400 3.6e-03

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLK      1 - 70
NLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELP     71 - 140
CLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN                        141 - 190
//

Text Mined References (10)

PMID Year Title