Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 3.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000
Pick disease 2.100 0.000
chronic rhinosinusitis -1.101 0.025

Gene RIF (6)

PMID Text
22018492 DNAL1 and MAP4 may exert their functions in the HIV life cycle at reverse transcription, prior to nuclear translocation.
22018492 Knockdown of dynein, axonemal, light chain 1 (DNAL1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
21496787 DNAL1 mutation could help to elucidate the interaction between the DNAL1 to dynein heavy chain and to tubulin.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of dynein, axonemal, light chain 1 (DNAL1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15845866 identification of the human (DNAL1) ortholog of the Chlamydomonas LC1-gene; protein interaction studies demonstrated binding of DNAL1 and DNAH5; DNAL1 considered a candidate for primary ciliary dyskinesia

AA Sequence

MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLK      1 - 70
NLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELP     71 - 140
CLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN                        141 - 190
//

Text Mined References (10)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22018492 2012 Knockdown of MAP4 and DNAL1 produces a post-fusion and pre-nuclear translocation impairment in HIV-1 replication.
21496787 2011 Primary ciliary dyskinesia caused by homozygous mutation in DNAL1, encoding dynein light chain 1.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15845866 2005 Identification and analysis of axonemal dynein light chain 1 in primary ciliary dyskinesia patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.