Property Summary

NCBI Gene PubMed Count 24
PubMed Score 12.53
PubTator Score 15.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.38393646926586E-14
posterior fossa group A ependymoma 1511 2.18154983071492E-11
non-small cell lung cancer 2798 4.64723651313816E-10
malignant mesothelioma 3163 1.53117374888999E-8
pituitary cancer 1972 1.99423107396068E-6
ovarian cancer 8492 2.18499160554022E-5
chronic lymphocytic leukemia 244 2.59326938925777E-5
ulcerative colitis 2087 5.84805082120027E-5
medulloblastoma, large-cell 6234 2.03952715174461E-4
interstitial cystitis 2299 5.23130321962056E-4
lung cancer 4473 5.8333986979854E-4
osteosarcoma 7933 7.92013637880714E-4
sonic hedgehog group medulloblastoma 1482 0.00123119583051158
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00378759277762745
glioblastoma 5572 0.00417043665897882
pancreatic cancer 2300 0.00450952950783365
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0101352833962068
invasive ductal carcinoma 2950 0.0127942410589085
adrenocortical carcinoma 1427 0.0209122385598
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0289982345276869
Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 1.0

Expression

Synonym

Accession Q4L180 B2CNV7 B2CNV8 Q13597 Q2YDY5 Q6KFX5 Q6KFX6 Q6KFX7 Q8IUM3 Q8N6Z0
Symbols DOC1
DOC-1
GIP90
GIP130

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (10)

PMID Text
24340050 down-regulation of FILIP1L associated with DNA methylation is related with the invasive phenotype in various cancers.
24327474 these findings suggest that FILIP1L reduces beta-catenin levels, which may lead to the transcriptional downregulation of WNT target genes such as MMPs, resulting in inhibition of metastasis
23512105 In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample.
21832087 GPBP directs myofibril formation through interaction with intracellular downstream effector 130-kDa GPBP-interacting protein
21784850 a novel function for FILIP-1L and a pathway for Hsf1 degradation through the ubiquitin-proteasome system.
21693594 these findings suggest that downregulation of FILIP1L associated with DNA methylation is related with the invasive phenotype in ovarian cancer and that modulation of FILIP1L expression has the potential to be a target for ovarian cancer therapy.
20635389 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19270026 Observational study of gene-disease association. (HuGE Navigator)
15935955 DOC1 might play a role in mediating some of the effects of EMAP-II on endothelial cells

AA Sequence

MRSRGSDTEGSAQKKFPRHTKGHSFQGPKNMKHRQQDKDSPSESDVILPCPKAEKPHSGNGHQAEDLSRD      1 - 70
DLLFLLSILEGELQARDEVIGILKAEKMDLALLEAQYGFVTPKKVLEALQRDAFQAKSTPWQEDIYEKPM     71 - 140
NELDKVVEKHKESYRRILGQLLVAEKSRRQTILELEEEKRKHKEYMEKSDEFICLLEQECERLKKLIDQE    141 - 210
IKSQEEKEQEKEKRVTTLKEELTKLKSFALMVVDEQQRLTAQLTLQRQKIQELTTNAKETHTKLALAEAR    211 - 280
VQEEEQKATRLEKELQTQTTKFHQDQDTIMAKLTNEDSQNRQLQQKLAALSRQIDELEETNRSLRKAEEE    281 - 350
LQDIKEKISKGEYGNAGIMAEVEELRKRVLDMEGKDEELIKMEEQCRDLNKRLERETLQSKDFKLEVEKL    351 - 420
SKRIMALEKLEDAFNKSKQECYSLKCNLEKERMTTKQLSQELESLKVRIKELEAIESRLEKTEFTLKEDL    421 - 490
TKLKTLTVMFVDERKTMSEKLKKTEDKLQAASSQLQVEQNKVTTVTEKLIEETKRALKSKTDVEEKMYSV    491 - 560
TKERDDLKNKLKAEEEKGNDLLSRVNMLKNRLQSLEAIEKDFLKNKLNQDSGKSTTALHQENNKIKELSQ    561 - 630
EVERLKLKLKDMKAIEDDLMKTEDEYETLERRYANERDKAQFLSKELEHVKMELAKYKLAEKTETSHEQW    631 - 700
LFKRLQEEEAKSGHLSREVDALKEKIHEYMATEDLICHLQGDHSVLQKKLNQQENRNRDLGREIENLTKE    701 - 770
LERYRHFSKSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLYEESENQDEDPND    771 - 840
EGSVLSFKCSQSTPCPVNRKLWIPWMKSKEGHLQNGKMQTKPNANFVQPGDLVLSHTPGQPLHIKVTPDH    841 - 910
VQNTATLEITSPTTESPHSYTSTAVIPNCGTPKQRITILQNASITPVKSKTSTEDLMNLEQGMSPITMAT    911 - 980
FARAQTPESCGSLTPERTMSPIQVLAVTGSASSPEQGRSPEPTEISAKHAIFRVSPDRQSSWQFQRSNSN    981 - 1050
SSSVITTEDNKIHIHLGSPYMQAVASPVRPASPSAPLQDNRTQGLINGALNKTTNKVTSSITITPTATPL   1051 - 1120
PRQSQITVEPLLLPH                                                          1121 - 1135
//

Text Mined References (28)

PMID Year Title
24340050 2013 Down-regulation of Filamin A interacting protein 1-like Is associated with promoter methylation and an invasive phenotype in breast, colon, lung and pancreatic cancers [corrected].
24327474 2014 Filamin A interacting protein 1-like inhibits WNT signaling and MMP expression to suppress cancer cell invasion and metastasis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23174249 2013 CpG island hypermethylation frequently silences FILIP1L isoform 2 expression in prostate cancer.
22900064 2012 Sensitivity to TOP2 targeting chemotherapeutics is regulated by Oct1 and FILIP1L.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
21832087 2011 Goodpasture antigen-binding protein (GPBP) directs myofibril formation: identification of intracellular downstream effector 130-kDa GPBP-interacting protein (GIP130).
More...