Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.51
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.414 0.000
posterior fossa group B ependymoma -1.600 0.000
sonic hedgehog group medulloblastoma 1.800 0.000
adrenocortical carcinoma -2.190 0.000
breast carcinoma 2.300 0.001
pilocytic astrocytoma -1.500 0.000
Breast cancer 1.300 0.000

Gene RIF (1)

PMID Text
23455491 NKAIN1-SERINC2 gene expression is associated with alcohol dependence in subjects of European descent.

AA Sequence

MGKCSGRCTLVAFCCLQLVAALERQIFDFLGYQWAPILANFLHIMAVILGIFGTVQYRSRYLILYAAWLV      1 - 70
LWVGWNAFIICFYLEVGQLSQDRDFIMTFNTSLHRSWWMENGPGCLVTPVLNSRLALEDHHVISVTGCLL     71 - 140
DYPYIEALSSALQIFLALFGFVFACYVSKVFLEEEDSFDFIGGFDSYGYQAPQKTSHLQLQPLYTSG       141 - 207
//

Text Mined References (6)

PMID Year Title
23455491 2013 NKAIN1-SERINC2 is a functional, replicable and genome-wide significant risk gene region specific for alcohol dependence in subjects of European descent.
17606467 2007 A novel family of transmembrane proteins interacting with beta subunits of the Na,K-ATPase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.