Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 5.7e-07
spina bifida 1074 2.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.200 5.7e-07
spina bifida 1.302 2.9e-02

 Compartment GO Term (1)

AA Sequence

MEPELLVRKVSALQACVRGFLVRRQFQSLRAEYEAIVREVEGDLGTLQWTEGRIPRPRFLPEKAKSHQTW      1 - 70
KAGDRVANPEQGLWNHFPCEESEGEATWEEMVLKKSGESSANQGSLCRDHSSWLQMKQNRKPSQEKTRDT     71 - 140
TRMENPEATDQRLPHSQPQLQELQYHRSHLAMELLWLQQAINSRKEYLLLKQTLRSPEAGPIREEPRVFL    141 - 210
EHGEQACERDQSQPSAPLEDQSYRDRTTGELEQEDDSCHRVKSPHRSPGSLATTQKNIAGAKCREPCYSK    211 - 280
SGPPSSIPSNSQALGDRLTKGPDDGRQTFGGTCLLQMKILEDQTPRGLKPRNHCPRKSRTQLSALYEDSN    281 - 350
IKEMSPRKLDHKEPDCRTVRTQELGLSEDHIIWDGTLGGPEHSVLDLWRTKPPKGQAPTDRSSRDGTSNE    351 - 420
PSHEGQKKQRTIPWRSKSPEILSSTKAGCTGEEQWRGRPWKTEPPG                            421 - 466
//

Text Mined References (7)

PMID Year Title