Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.500 1.7e-02
oligodendroglioma 1.300 2.9e-02
osteosarcoma 1.318 1.6e-02
ovarian cancer -2.300 1.1e-05
progressive supranuclear palsy 1.100 5.8e-03

AA Sequence

MLPSTMFLVHLPLSTNRLHCLRNTSLESYLCSFVHLNHPLHISDRVILISLHEAVRFSFAFSFPRGTLSI      1 - 70
AYCLMSSVSTSSEAIMSTELLANYCHSSLHVCICISSFPNETGNHDSFPGAVVSISDQPTDQCKLAAKEL     71 - 140
PLRNLLECRFFDCMGEEDLINLGVIGTER                                             141 - 169
//

Text Mined References (5)

PMID Year Title