Property Summary

NCBI Gene PubMed Count 34
Grant Count 57
R01 Count 34
Funding $10,484,048.81
PubMed Score 292.07
PubTator Score 33.43

Knowledge Summary

Patent (1,847)

Expression

Gene RIF (15)

PMID Text
26936867 facilitates transbilayer migration of lipids [review]
26481309 deficiency in Ano6 resulted in reduced viability with increased bleeding time
26448322 ANO6 is highly expressed in apoptotic cyst epithelial cells of human polycystic kidneys.
26108457 Ion channel and lipid scramblase activity associated with expression of TMEM16F/ANO6 isoforms
26057829 Homology modeling shows that the scramblase domain forms an unusual hydrophilic cleft that faces the lipid bilayer and may function to facilitate translocation of phospholipid between membrane leaflets.
25651887 Ano6 mediates effects essential for innate immunity downstream of P2X7 receptors in macrophages.
25589784 using human osteoblasts and osteoblasts from Ano6(-/-) and WT mice, we demonstrate that NCX1 requires Ano6 to efficiently translocate Ca(2+) out of osteoblasts into the calcifying bone matrix
24478309 TMEM16A and -16F use a similar mechanism for sorting to plasma membrane and protein stabilization, but their functional domains significantly differ
23618909 Anoo6 induces a chloride ion conductance along with a smaller nonselective cation conductance that is activated either calcium ion dependently (ionomycin) or calcium independently(fas receptor), but not during mitochondrial apoptosis.
23426967 TMEM16F is an essential component of a divalent calcium ion-activated Cl- channel with a divalent calcium ion sensitivity that is distinct from that of TMEM16A/B and not related to volume-sensitive outwardly rectifying Cl- channel (VSOR) activity.
More...

AA Sequence

MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRID      1 - 70
FVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIM     71 - 140
HIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSR    141 - 210
IVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYK    211 - 280
KQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQ    281 - 350
CDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP    351 - 420
EYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPK    421 - 490
NINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFV    491 - 560
NYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWIM    561 - 630
NLIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIR    631 - 700
VDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSY    701 - 770
TMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV    771 - 840
MEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEAVDNNLRPKSE    841 - 910
//

Text Mined References (44)

PMID Year Title
26936867 2016 Getting to the Outer Leaflet: Physiology of Phosphatidylserine Exposure at the Plasma Membrane.
26481309 2016 Survival protein anoctamin-6 controls multiple platelet responses including phospholipid scrambling, swelling, and protein cleavage.
26448322 2015 Anoctamin 6 is localized in the primary cilium of renal tubular cells and is involved in apoptosis-dependent cyst lumen formation.
26108457 2015 Ion channel and lipid scramblase activity associated with expression of TMEM16F/ANO6 isoforms.
26057829 2015 Identification of a lipid scrambling domain in ANO6/TMEM16F.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25651887 2015 Anoctamin 6 mediates effects essential for innate immunity downstream of P2X7 receptors in macrophages.
25589784 2015 Anoctamin-6 controls bone mineralization by activating the calcium transporter NCX1.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
24478309 2014 Functional swapping between transmembrane proteins TMEM16A and TMEM16F.
More...