| Tbio | Anoctamin-6 |
Small-conductance calcium-activated nonselective cation (SCAN) channel which acts as a regulator of phospholipid scrambling in platelets and osteoblasts. Phospholipid scrambling results in surface exposure of phosphatidylserine which in platelets is essential to trigger the clotting system whereas in osteoblasts is essential for the deposition of hydroxyapatite during bone mineralization. Has calcium-dependent phospholipid scramblase activity; scrambles phosphatidylserine, phosphatidylcholine and galactosylceramide (By similarity). Can generate outwardly rectifying chloride channel currents in airway epithelial cells and Jurkat T lymphocytes.
This gene encodes a multi-pass transmembrane protein that belongs to the anoctamin family. This protein is an essential component for the calcium-dependent exposure of phosphatidylserine on the cell surface. The scrambling of phospholipid occurs in various biological systems, such as when blood platelets are activated, they expose phosphatidylserine to trigger the clotting system. Mutations in this gene are associated with Scott syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]
This gene encodes a multi-pass transmembrane protein that belongs to the anoctamin family. This protein is an essential component for the calcium-dependent exposure of phosphatidylserine on the cell surface. The scrambling of phospholipid occurs in various biological systems, such as when blood platelets are activated, they expose phosphatidylserine to trigger the clotting system. Mutations in this gene are associated with Scott syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| glioblastoma multiforme | 347 | 6.46377819216717E-30 |
| lung carcinoma | 2844 | 7.88728037909924E-15 |
| pilocytic astrocytoma | 3086 | 5.63891632517558E-11 |
| lung adenocarcinoma | 2714 | 6.71304347084114E-10 |
| oligodendroglioma | 2849 | 2.4562816205088E-9 |
| posterior fossa group A ependymoma | 1511 | 2.71092902496986E-9 |
| ovarian cancer | 8492 | 3.50586796710134E-8 |
| osteosarcoma | 7933 | 2.1794114207354E-6 |
| atypical teratoid/rhabdoid tumor | 1095 | 6.77513756137155E-6 |
| adult high grade glioma | 2148 | 4.81189830234993E-5 |
| primary pancreatic ductal adenocarcinoma | 1271 | 5.15950828936586E-4 |
| sonic hedgehog group medulloblastoma | 1482 | 6.21096901298432E-4 |
| ductal carcinoma in situ | 1745 | 0.00113120470612912 |
| invasive ductal carcinoma | 2950 | 0.00159734849979981 |
| pancreatic cancer | 2300 | 0.00251495261563657 |
| subependymal giant cell astrocytoma | 2287 | 0.0217189443289678 |
| astrocytic glioma | 2241 | 0.0257406127806923 |
| active ulcerative colitis | 477 | 0.028087403159098 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Ankylosing spondylitis | 138 | 0.0 | 2.0 |
| Cardiovascular system disease | 194 | 0.0 | 2.0 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Teratoma | 4 | 5.134 | 2.6 |
| Sertoli cell tumor | 9 | 4.3 | 2.2 |
| Polyhydramnios | 29 | 3.597 | 1.8 |
| Vertebrobasilar insufficiency | 8 | 3.197 | 1.6 |
| Pancreatoblastoma | 2 | 3.153 | 1.6 |
| Disease | Target Count |
|---|---|
| Scott syndrome | 1 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | 1.400 | 0.026 |
| glioblastoma multiforme | 1.800 | 0.000 |
| oligodendroglioma | 1.100 | 0.000 |
| osteosarcoma | 1.776 | 0.000 |
| posterior fossa group A ependymoma | 1.600 | 0.000 |
| atypical teratoid/rhabdoid tumor | 1.400 | 0.000 |
| primary pancreatic ductal adenocarcinoma | 1.444 | 0.001 |
| active ulcerative colitis | 2.954 | 0.028 |
| adult high grade glioma | 1.800 | 0.000 |
| pilocytic astrocytoma | 2.500 | 0.000 |
| sonic hedgehog group medulloblastoma | 1.300 | 0.001 |
| subependymal giant cell astrocytoma | 1.816 | 0.022 |
| lung adenocarcinoma | -1.200 | 0.000 |
| lung carcinoma | -2.000 | 0.000 |
| ductal carcinoma in situ | -1.200 | 0.001 |
| invasive ductal carcinoma | -1.800 | 0.002 |
| ovarian cancer | -1.900 | 0.000 |
| pancreatic cancer | 1.200 | 0.003 |
| Species | Source |
|---|---|
| Chimp | OMA EggNOG |
| Macaque | OMA EggNOG Inparanoid |
| Mouse | OMA EggNOG Inparanoid |
| Dog | OMA EggNOG Inparanoid |
| Cow | OMA EggNOG Inparanoid |
| Pig | OMA EggNOG Inparanoid |
| Platypus | EggNOG Inparanoid |
| Chicken | OMA EggNOG Inparanoid |
| Anole lizard | OMA EggNOG Inparanoid |
| Xenopus | OMA EggNOG Inparanoid |
| PMID | Text |
|---|---|
| 26936867 | facilitates transbilayer migration of lipids [review] |
| 26481309 | deficiency in Ano6 resulted in reduced viability with increased bleeding time |
| 26448322 | ANO6 is highly expressed in apoptotic cyst epithelial cells of human polycystic kidneys. |
| 26108457 | Ion channel and lipid scramblase activity associated with expression of TMEM16F/ANO6 isoforms |
| 26057829 | Homology modeling shows that the scramblase domain forms an unusual hydrophilic cleft that faces the lipid bilayer and may function to facilitate translocation of phospholipid between membrane leaflets. |
| 25651887 | Ano6 mediates effects essential for innate immunity downstream of P2X7 receptors in macrophages. |
| 25589784 | using human osteoblasts and osteoblasts from Ano6(-/-) and WT mice, we demonstrate that NCX1 requires Ano6 to efficiently translocate Ca(2+) out of osteoblasts into the calcifying bone matrix |
| 24478309 | TMEM16A and -16F use a similar mechanism for sorting to plasma membrane and protein stabilization, but their functional domains significantly differ |
| 23618909 | Anoo6 induces a chloride ion conductance along with a smaller nonselective cation conductance that is activated either calcium ion dependently (ionomycin) or calcium independently(fas receptor), but not during mitochondrial apoptosis. |
| 23426967 | TMEM16F is an essential component of a divalent calcium ion-activated Cl- channel with a divalent calcium ion sensitivity that is distinct from that of TMEM16A/B and not related to volume-sensitive outwardly rectifying Cl- channel (VSOR) activity. |
| More... |
MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRID 1 - 70 FVLVYEDESRKETNKKGTNEKQRRKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIM 71 - 140 HIKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSR 141 - 210 IVYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYK 211 - 280 KQPLDLIRKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQ 281 - 350 CDRLCPFWKLNITCESSKKLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP 351 - 420 EYEARCTHVVINEITQEEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPK 421 - 490 NINGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNFELPRTQTDYENSLTMKMFLFQFV 491 - 560 NYYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEECDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWIM 561 - 630 NLIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEMIIQFGFVTLFVASFPLAPLLALVNNILEIR 631 - 700 VDAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTNAMIIAFTSDMIPRLVYYWSFSVPPYGDHTSY 701 - 770 TMEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV 771 - 840 MEHVIYSVKFFISYAIPDVSKRTKSKIQREKYLTQKLLHENHLKDMTKNMGVIAERMIEAVDNNLRPKSE 841 - 910 //
| PMID | Year | Title |
|---|---|---|
| 26936867 | 2016 | Getting to the Outer Leaflet: Physiology of Phosphatidylserine Exposure at the Plasma Membrane. |
| 26481309 | 2016 | Survival protein anoctamin-6 controls multiple platelet responses including phospholipid scrambling, swelling, and protein cleavage. |
| 26448322 | 2015 | Anoctamin 6 is localized in the primary cilium of renal tubular cells and is involved in apoptosis-dependent cyst lumen formation. |
| 26108457 | 2015 | Ion channel and lipid scramblase activity associated with expression of TMEM16F/ANO6 isoforms. |
| 26057829 | 2015 | Identification of a lipid scrambling domain in ANO6/TMEM16F. |
| 25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
| 25651887 | 2015 | Anoctamin 6 mediates effects essential for innate immunity downstream of P2X7 receptors in macrophages. |
| 25589784 | 2015 | Anoctamin-6 controls bone mineralization by activating the calcium transporter NCX1. |
| 24692353 | 2014 | Structure and function of TMEM16 proteins (anoctamins). |
| 24478309 | 2014 | Functional swapping between transmembrane proteins TMEM16A and TMEM16F. |
| More... |
