Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.43971149994648E-8
tuberculosis 1563 1.58699433640498E-7
oligodendroglioma 2849 0.0181831880541353
group 3 medulloblastoma 2254 0.0414380560555647

Expression

  Differential Expression (4)

Disease log2 FC p
oligodendroglioma -1.100 0.018
osteosarcoma -3.693 0.000
tuberculosis -4.000 0.000
group 3 medulloblastoma -1.100 0.041

Synonym

Accession Q4KMG9 Q96NA7
Symbols C12orf59

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

AA Sequence

MGVRVHVVAASALLYFILLSGTRCEENCGNPEHCLTTDWVHLWYIWLLVVIGALLLLCGLTSLCFRCCCL      1 - 70
SRQQNGEDGGPPPCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLPSSLDTLPGYEE     71 - 140
ALHMSRFTVAMCGQKAPDLPPVPEEKQLPPTEKESTRIVDSWN                               141 - 183
//

Text Mined References (7)

PMID Year Title
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.