Property Summary

NCBI Gene PubMed Count 24
Grant Count 76
R01 Count 58
Funding $6,907,506.14
PubMed Score 437.01
PubTator Score 32.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.500 0.000
posterior fossa group A ependymoma 2.000 0.000
oligodendroglioma 1.600 0.005
osteosarcoma 2.083 0.001
cystic fibrosis 1.809 0.000
atypical teratoid / rhabdoid tumor 2.000 0.001
Duchenne muscular dystrophy 1.006 0.000
X-linked cerebral adrenoleukodystrophy -2.000 0.031
colon cancer -1.400 0.020
lung cancer -1.600 0.001
lung adenocarcinoma -1.300 0.000
group 3 medulloblastoma 1.700 0.010
psoriasis -1.100 0.000
subependymal giant cell astrocytoma -1.816 0.018
Breast cancer -1.400 0.034
invasive ductal carcinoma -2.000 0.004
lung carcinoma -1.400 0.000
ductal carcinoma in situ -1.500 0.010
ovarian cancer -5.000 0.000

Synonym

Accession Q4KMG0 O14631
Symbols CDO
CDON1
HPE11
ORCAM

Gene

PDB

3N1Q   3D1M   3N1F  

Gene RIF (12)

PMID Text
26529631 We identified a novel heterozygous nonsense CDON mutation in a case of Pituitary Stalk Interruption Syndrome who presented with neonatal hypoglycemia and cholestasis
25369201 CDO is required for proliferation and survival of lung cancer cells via Hh signaling.
25313246 These data support the view that cell-adhesion molecule-related/downregulated by oncogenes (CDON) acts as a tumor suppressor in neuroblastomas, and that CDON is tightly regulated by miRNAs.
24740842 Single-nucleotide polymorphism in CDON is associated with biochemical recurrence in prostate cancer.
22326621 Mutations in the CDON cause holoprosencephaly. (Review)
21849809 We found that CDON is overexpressed in prostate cancer
21802063 CDON must associate with both ligand and other hedgehog-receptor components, particularly PTCH1, for signaling to occur and disruption of the latter interactions is a mechanism of holoprosencephaly.
20519495 Hedgehog proteins interact with cell adhesion molecule, down-regulated by oncogenes (CDO) and brother of CDO (BOC) in a conserved manner
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
12720294 CDO and BOC play a role in differentiation of cells in the skeletal muscle lineage
More...

AA Sequence

MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAQPVTTRISWLHNGKTLDG      1 - 70
NLEHVKIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIG     71 - 140
CRVPESNPKAEVRYKIRGKWLEHSTENYLILPSGNLQILNVSLEDKGSYKCAAYNPVTHQLKVEPIGRKL    141 - 210
LVSRPSSDDVHILHPTHSQALAVLSRSPVTLECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSV    211 - 280
DPADSGNYSCMAGNKSGDVKYVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQ    281 - 350
PIHPSARHLTAGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGD    351 - 420
FVTLSCNASGLPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAV    421 - 490
TQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHP    491 - 560
SAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRAGKDGGLPINAYFVKYRKLDDGVGMLGSWHT    561 - 630
VRVPGSENELHLAELEPSSLYEVLMVARSAAGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPVVS    631 - 700
EAANNNFGVVLTDSSRHSGVPEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAA    701 - 770
EDIPPSKLSVEVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSRPITGPHIAYTEAVSD    771 - 840
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEG    841 - 910
GESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPARSSDMLYLIVGCVLGVMVLIL    911 - 980
MVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYTTLSGASQINGNVHGGFLTNGGLSSGYSHLH    981 - 1050
HKVPNAVNGIVNGSLNGGLYSGHSNSLTRTHVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRC   1051 - 1120
FTKTNSTFSSSPPPVVPVVAPYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCC   1121 - 1190
QDIVNDVSSDGSEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEG   1191 - 1260
CAEKTMWSPPGIPLDSPTEVLQQPRET                                              1261 - 1287
//

Text Mined References (25)

PMID Year Title
26529631 2016 A Nonsense Mutation in the Hedgehog Receptor CDON Associated With Pituitary Stalk Interruption Syndrome.
25369201 2014 CDO, an Hh-coreceptor, mediates lung cancer cell proliferation and tumorigenicity through Hedgehog signaling.
25313246 2014 Regulation by miR181 family of the dependence receptor CDON tumor suppressive activity in neuroblastoma.
24740842 2014 Genetic variants in microRNAs and microRNA target sites predict biochemical recurrence after radical prostatectomy in localized prostate cancer.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
22881374 2012 Genome-wide association and linkage study in the Amish detects a novel candidate late-onset Alzheimer disease gene.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22326621 2012 Cdon and Boc: Two transmembrane proteins implicated in cell-cell communication.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21849809 2011 Identification of transmembrane protein in prostate cancer by the Escherichia coli ampicillin secretion trap: expression of CDON is involved in tumor cell growth and invasion.
More...