Property Summary

NCBI Gene PubMed Count 25
PubMed Score 471.81
PubTator Score 32.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Gastrointestinal Stromal Tumors 48 0.0 0.0
Holoprosencephaly 11 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.9
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.2
Breast cancer 3578 0.0 0.0341231221412272

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer -1.400 3.4e-02
atypical teratoid / rhabdoid tumor 2.000 6.4e-04
colon cancer -1.400 2.0e-02
cystic fibrosis 1.809 8.0e-06
Duchenne muscular dystrophy 1.006 3.0e-06
ductal carcinoma in situ -1.500 9.9e-03
ependymoma 1.400 3.2e-02
group 3 medulloblastoma 1.700 9.8e-03
invasive ductal carcinoma -1.729 9.4e-04
lung adenocarcinoma -1.300 8.2e-13
lung cancer -1.600 1.3e-03
lung carcinoma -1.400 9.3e-12
oligodendroglioma 1.600 5.3e-03
osteosarcoma 1.583 2.0e-04
ovarian cancer -5.000 1.6e-19
psoriasis -1.100 3.0e-22
subependymal giant cell astrocytoma -1.816 1.8e-02
urothelial carcinoma -1.500 8.2e-07
X-linked cerebral adrenoleukodystrophy -2.000 3.1e-02

 OMIM Phenotype (1)

 CSPA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MHPDLGPLCTLLYVTLTILCSSVSSDLAPYFTSEPLSAVQKLGGPVVLHCSAQPVTTRISWLHNGKTLDG      1 - 70
NLEHVKIHQGTLTILSLNSSLLGYYQCLANNSIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIG     71 - 140
CRVPESNPKAEVRYKIRGKWLEHSTENYLILPSGNLQILNVSLEDKGSYKCAAYNPVTHQLKVEPIGRKL    141 - 210
LVSRPSSDDVHILHPTHSQALAVLSRSPVTLECVVSGVPAPQVYWLKDGQDIAPGSNWRRLYSHLATDSV    211 - 280
DPADSGNYSCMAGNKSGDVKYVTYMVNVLEHASISKGLQDQIVSLGATVHFTCDVHGNPAPNCTWFHNAQ    281 - 350
PIHPSARHLTAGNGLKISGVTVEDVGMYQCVADNGIGFMHSTGRLEIENDGGFKPVIITAPVSAKVADGD    351 - 420
FVTLSCNASGLPVPVIRWYDSHGLITSHPSQVLRSKSRKSQLSRPEGLNLEPVYFVLSQAGASSLHIQAV    421 - 490
TQEHAGKYICEAANEHGTTQAEASLMVVPFETNTKAETVTLPDAAQNDDRSKRDGSETGLLSSFPVKVHP    491 - 560
SAVESAPEKNASGISVPDAPIILSPPQTHTPDTYNLVWRAGKDGGLPINAYFVKYRKLDDGVGMLGSWHT    561 - 630
VRVPGSENELHLAELEPSSLYEVLMVARSAAGEGQPAMLTFRTSKEKTASSKNTQASSPPVGIPKYPVVS    631 - 700
EAANNNFGVVLTDSSRHSGVPEAPDRPTISTASETSVYVTWIPRANGGSPITAFKVEYKRMRTSNWLVAA    701 - 770
EDIPPSKLSVEVRSLEPGSTYKFRVIAINHYGESFRSSASRPYQVVGFPNRFSSRPITGPHIAYTEAVSD    771 - 840
TQIMLKWTYIPSSNNNTPIQGFYIYYRPTDSDNDSDYKRDVVEGSKQWHMIGHLQPETSYDIKMQCFNEG    841 - 910
GESEFSNVMICETKVKRVPGASEYPVKDLSTPPNSLGSGGNVGPATSPARSSDMLYLIVGCVLGVMVLIL    911 - 980
MVFIAMCLWKNRQQNTIQKYDPPGYLYQGSDMNGQMVDYTTLSGASQINGNVHGGFLTNGGLSSGYSHLH    981 - 1050
HKVPNAVNGIVNGSLNGGLYSGHSNSLTRTHVDFEHPHHLVNGGGMYTAVPQIDPLECVNCRNCRNNNRC   1051 - 1120
FTKTNSTFSSSPPPVVPVVAPYPQDGLEMKPLSHVKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTCC   1121 - 1190
QDIVNDVSSDGSEDPAEFSRGQEGMINLRIPDHLQLAKSCVWEGDSCAHSETEINIVSWNALILPPVPEG   1191 - 1260
CAEKTMWSPPGIPLDSPTEVLQQPRET                                              1261 - 1287
//

Text Mined References (25)

PMID Year Title