Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.72
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.700 1.5e-04
Astrocytoma, Pilocytic -2.600 2.6e-06
atypical teratoid / rhabdoid tumor -3.500 1.7e-08
Breast cancer -1.100 1.4e-02
cutaneous lupus erythematosus -1.100 5.4e-03
ependymoma -2.300 3.5e-07
glioblastoma -2.800 1.5e-11
group 3 medulloblastoma -2.500 1.0e-02
medulloblastoma, large-cell -2.900 2.1e-03
non primary Sjogren syndrome sicca -2.100 3.2e-04
primitive neuroectodermal tumor -3.000 3.7e-03

Gene RIF (1)

AA Sequence

MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRNFPHNDYEDVF      1 - 70
EEPSESGSDPSMWTARGPFRRDRWSSEDEEAAGPSQALSPLLSDTRKIVSEGELDQLAQIRPLIFNFHEQ     71 - 140
TAIKDCLKILEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTRVPLGKSKDYIN    141 - 210
ASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIAMITREIEGGIIKCYHYWPISLKKPLELK    211 - 280
HFRVFLENYQILQYFIIRMFQVVEKSTGTSHSVKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMV    281 - 350
VHCSAGIGRTGVFLCVDVVFCAIVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD    351 - 420
//

Text Mined References (5)

PMID Year Title