Property Summary

NCBI Gene PubMed Count 2
PubMed Score 29.25
PubTator Score 5.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 2.9e-04
osteosarcoma 7950 2.2e-03
Disease Target Count Z-score Confidence
Prediabetes syndrome 1 3.262 1.6
Chronic venous insufficiency 1 3.202 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.587 2.2e-03
tuberculosis -1.100 2.9e-04

AA Sequence

MEALLSTPINPNNFPAKLWRLVNSPRYRSIRWDGRGEGLLIDQPLFEAELLSPPGPGGGGGTAGAGAEPE      1 - 70
LFKTTSFTSFIRQLNLYGFRKVVLGGPGGGKPAGNGPLHHFHNPHFRRDQPQLLVHLKRLTSANKAKLAA     71 - 140
GLEVPCRPPNRFQRLLITSASAATAPLQHQQPPPPAGPRPEPHGPVAVGQFHRSFRRDSLSPYSCVSTPS    141 - 210
HDHSTYPLKGLDRTPVPHRIWQNSLGMHPGQVETSPTFSDKGVPFPVLQRFPTEVTYTLQPSTTSVHVQQ    211 - 280
GPQTMVSSSQKYSNYTPSAQYSQAYYPTAVLQCCSPTHMDALSSCVTPNASSYAHCNYFQNPSMQSSYPV    281 - 350
EFLPSNWPCSTTDENTKTEVNLEAVFQIVDELHSSPKLEMVKVEPVENQCPTSPSYRGQHILANSNNSNP    351 - 420
CSASQASQLEPLTPVGSDIMSFVVGTEQAVACSLPQSPEYIYTIHTAQPVENSTIQESAAIQQAHVKLKE    421 - 490
HLNHNPSPSSVVFVQEGPPFSTHQVDANIKCQTSSRENILPSEQMGFLISEMGPASKPSEDTGLATPARY    491 - 560
REHRSNSQQGKSPDLHLLVDVACKQERFPKEEELKE                                      561 - 596
//

Text Mined References (5)

PMID Year Title