Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.19
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 3.87447536669002E-7
tuberculosis and treatment for 6 months 686 9.09341926181343E-7
sonic hedgehog group medulloblastoma 1482 1.15338944195321E-5
hepatocellular carcinoma 550 8.04555046985523E-4
osteosarcoma 7933 0.00118402754828334
spina bifida 1064 0.0294440173606223

Expression

  Differential Expression (6)

Disease log2 FC p
hepatocellular carcinoma 1.200 0.001
osteosarcoma -1.252 0.001
tuberculosis and treatment for 6 months -2.200 0.000
sonic hedgehog group medulloblastoma -1.300 0.000
spina bifida -1.347 0.029
Breast cancer 1.200 0.000

Synonym

Accession Q4G0X4 B4DTR0
Symbols KCASH2

Gene

PANTHER Protein Class (1)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
21472142 Rescuing KCASHs expression reduces the Hedgehog-dependent medulloblastoma growth, suggesting that loss of members of this novel family of native HDAC inhibitors is crucial in sustaining Hh pathway-mediated tumorigenesis.

AA Sequence

MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDL      1 - 70
PEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLNQRVQTVHFTVREAPQIYSLSSSS     71 - 140
MEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVEGLPEEEYTKQNLKRLWV    141 - 210
VPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR                        211 - 260
//

Text Mined References (5)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21472142 2011 Identification and characterization of KCASH2 and KCASH3, 2 novel Cullin3 adaptors suppressing histone deacetylase and Hedgehog activity in medulloblastoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.