Property Summary

NCBI Gene PubMed Count 4
PubMed Score 75.72
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.06827247446159E-8
Pick disease 1893 1.24080335376532E-5
osteosarcoma 7933 2.53702958114938E-5
medulloblastoma 1524 2.64416901738965E-4
medulloblastoma, large-cell 6234 2.69080326120394E-4
glioblastoma 5572 2.69530214663052E-4
astrocytic glioma 2241 0.0167430176185706
ependymoma 2514 0.0308674924931585
Disease Target Count Z-score Confidence
Intrahepatic cholestasis 19 3.482 1.7
Von Willebrand's disease 19 3.291 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 0.017
ependymoma -1.500 0.031
osteosarcoma -2.127 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
Pick disease -1.200 0.000

Synonym

Accession Q4G0W2
Symbols VHP
DUSP26

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG

Gene RIF (2)

PMID Text
26212664 Collectively, these results indicate that DUSP28 plays a key role in drug resistance and migratory activity in human pancreatic cells, and suggest that targeting DUSP28 might have clinical relevance in eradicating malignant pancreatic cancers.
25230705 Taken together, these data demonstrate that DUSP28 plays a significant role in HCC progression and may be a feasible molecular target for anti-cancer therapy.

AA Sequence

MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPV      1 - 70
FDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVA     71 - 140
EPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA                                      141 - 176
//

Text Mined References (5)

PMID Year Title
26212664 2015 Blockade of dual-specificity phosphatase 28 decreases chemo-resistance and migration in human pancreatic cancer cells.
25230705 2014 DUSP28 contributes to human hepatocellular carcinoma via regulation of the p38 MAPK signaling.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.