Property Summary

NCBI Gene PubMed Count 6
PubMed Score 88.72
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 1.7e-02
atypical teratoid / rhabdoid tumor -1.700 1.1e-08
ependymoma -1.500 3.1e-02
glioblastoma -1.200 2.7e-04
medulloblastoma -1.200 2.6e-04
medulloblastoma, large-cell -1.500 2.7e-04
osteosarcoma -2.127 2.5e-05
Pick disease -1.200 1.2e-05

Synonym

Accession Q4G0W2
Symbols VHP
DUSP26

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (4)

AA Sequence

MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPV      1 - 70
FDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVA     71 - 140
EPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA                                      141 - 176
//

Text Mined References (7)

PMID Year Title