Property Summary

NCBI Gene PubMed Count 4
Grant Count 34
R01 Count 17
Funding $7,575,348.16
PubMed Score 75.72
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.300 0.017
ependymoma -1.500 0.031
osteosarcoma -2.127 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
glioblastoma -1.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
Pick disease -1.200 0.000

Gene RIF (2)

PMID Text
26212664 Collectively, these results indicate that DUSP28 plays a key role in drug resistance and migratory activity in human pancreatic cells, and suggest that targeting DUSP28 might have clinical relevance in eradicating malignant pancreatic cancers.
25230705 Taken together, these data demonstrate that DUSP28 plays a significant role in HCC progression and may be a feasible molecular target for anti-cancer therapy.

AA Sequence

MGPAEAGRRGAASPVPPPLVRVAPSLFLGSARAAGAEEQLARAGVTLCVNVSRQQPGPRAPGVAELRVPV      1 - 70
FDDPAEDLLAHLEPTCAAMEAAVRAGGACLVYCKNGRSRSAAVCTAYLMRHRGLSLAKAFQMVKSARPVA     71 - 140
EPNPGFWSQLQKYEEALQAQSCLQGEPPALGLGPEA                                      141 - 176
//

Text Mined References (5)

PMID Year Title
26212664 2015 Blockade of dual-specificity phosphatase 28 decreases chemo-resistance and migration in human pancreatic cancer cells.
25230705 2014 DUSP28 contributes to human hepatocellular carcinoma via regulation of the p38 MAPK signaling.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.