Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q4G0S7 B3KXI4 B4E0P7 Q5BLP6
Symbols CH5400

Gene

 Compartment GO Term (0)

AA Sequence

MDQSSEGCMKKISSVNLDKLINDFSQIEKKMVETNGKNNILDIQLEKSNCLLKVMQAKEVSIKEECATLH      1 - 70
NIIKGLQQTIEYQQNLKGENEQLKISADLIKEKLKSHEQEYKNNIAKLVSEMKIKEEGYKKEISKLYQDM     71 - 140
QRKVELNEEKHKELIEKKEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQS    141 - 210
IYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF                              211 - 254
//

Text Mined References (5)

PMID Year Title
15809229 2005 Comparative gene finding in chicken indicates that we are closing in on the set of multi-exonic widely expressed human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.