Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.900 7.0e-03
Breast cancer -1.900 9.1e-05
ependymoma 2.100 4.0e-03
intraductal papillary-mucinous adenoma (... 1.100 1.0e-02
intraductal papillary-mucinous carcinoma... 1.200 1.3e-02
oligodendroglioma 2.000 2.4e-03
osteosarcoma 2.713 4.8e-08
ovarian cancer -1.500 4.2e-04
pancreatic ductal adenocarcinoma liver m... 2.380 2.6e-04
Pick disease 1.300 4.7e-09

AA Sequence

MDQSSEGCMKKISSVNLDKLINDFSQIEKKMVETNGKNNILDIQLEKSNCLLKVMQAKEVSIKEECATLH      1 - 70
NIIKGLQQTIEYQQNLKGENEQLKISADLIKEKLKSHEQEYKNNIAKLVSEMKIKEEGYKKEISKLYQDM     71 - 140
QRKVELNEEKHKELIEKKEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQS    141 - 210
IYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF                              211 - 254
//

Text Mined References (5)

PMID Year Title