Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 4.70804653373346E-9
osteosarcoma 7933 4.84499281506154E-8
Breast cancer 3099 9.09887928092465E-5
pancreatic ductal adenocarcinoma liver metastasis 1795 2.64159702745929E-4
ovarian cancer 8492 4.19596109970321E-4
oligodendroglioma 2849 0.00244777375967413
ependymoma 2514 0.00403150022525756
astrocytic glioma 2241 0.0069780809657561
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0100253441828587
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.013481026279736

Expression

  Differential Expression (10)

Synonym

Accession Q4G0S7 B3KXI4 B4E0P7 Q5BLP6
Symbols CH5400

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MDQSSEGCMKKISSVNLDKLINDFSQIEKKMVETNGKNNILDIQLEKSNCLLKVMQAKEVSIKEECATLH      1 - 70
NIIKGLQQTIEYQQNLKGENEQLKISADLIKEKLKSHEQEYKNNIAKLVSEMKIKEEGYKKEISKLYQDM     71 - 140
QRKVELNEEKHKELIEKKEMEISELNAKLRSQEKEKQNEIIKLQLEFDAKLARVQTKSKSYQDSTVLPQS    141 - 210
IYRRKLQHFQEEKNKEIAILRNTIRDLEQRLSVGKDSHLKRRRF                              211 - 254
//

Text Mined References (5)

PMID Year Title
15809229 2005 Comparative gene finding in chicken indicates that we are closing in on the set of multi-exonic widely expressed human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.