Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.46
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.600 0.006
primitive neuroectodermal tumor 2.500 0.019
psoriasis 1.200 0.000
facioscapulohumeral dystrophy 2.000 0.012

AA Sequence

MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRL      1 - 70
GCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRD     71 - 140
IQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREI    141 - 210
VKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQD    211 - 280
ENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAV    281 - 350
HAKTHGLLTPGGPIHVRFVNRK                                                    351 - 372
//

Text Mined References (7)

PMID Year Title
25376901 2014 Genetic markers associated with plasma protein C level in African Americans: the atherosclerosis risk in communities (ARIC) study.
20707712 2010 A genome-wide association study of self-rated health.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.