Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.46
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.80500736731907E-99
ependymoma 2514 0.00640931187567694
facioscapulohumeral dystrophy 286 0.0120691346975656
primitive neuroectodermal tumor 3031 0.0188704433877355

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.600 0.006
primitive neuroectodermal tumor 2.500 0.019
psoriasis 1.200 0.000
facioscapulohumeral dystrophy 2.000 0.012

Synonym

Accession Q4G0S4 Q6ZNI7
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRL      1 - 70
GCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRD     71 - 140
IQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREI    141 - 210
VKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQD    211 - 280
ENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAV    281 - 350
HAKTHGLLTPGGPIHVRFVNRK                                                    351 - 372
//

Text Mined References (7)

PMID Year Title
25376901 2014 Genetic markers associated with plasma protein C level in African Americans: the atherosclerosis risk in communities (ARIC) study.
20707712 2010 A genome-wide association study of self-rated health.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.