Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.243 0.037
medulloblastoma, large-cell -1.700 0.000
lung adenocarcinoma -1.300 0.000
posterior fossa group B ependymoma 1.100 0.000
nasopharyngeal carcinoma -1.200 0.000
lung carcinoma 1.300 0.000

Synonym

Accession Q4G0N7 B8ZZ33
Symbols C6orf225

Gene

 Compartment GO Term (1)

AA Sequence

MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPP      1 - 70
AQSSKEMHPK                                                                 71 - 80
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.