Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -1.300 3.2e-14
lung carcinoma 1.300 1.4e-07
medulloblastoma, large-cell -1.700 9.6e-06
nasopharyngeal carcinoma -1.200 1.1e-07
osteosarcoma 1.243 3.7e-02
posterior fossa group B ependymoma 1.100 9.7e-07

AA Sequence

MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPP      1 - 70
AQSSKEMHPK                                                                 71 - 80
//

Text Mined References (3)

PMID Year Title