Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.08
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma -1.122 3.4e-02
cystic fibrosis 1.132 1.5e-04
ependymoma 1.300 2.3e-07
non-small cell lung cancer 1.306 1.1e-13
osteosarcoma -1.355 1.8e-03
ovarian cancer 1.100 7.8e-04
pancreatic ductal adenocarcinoma liver m... -3.296 1.8e-04
progressive supranuclear palsy -1.300 6.5e-03
spina bifida -1.393 3.6e-02
tuberculosis and treatment for 6 months 1.100 4.4e-05

Gene RIF (4)

AA Sequence

MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR      1 - 70
VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK     71 - 140
RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY    141 - 210
RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI    211 - 280
GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR    281 - 350
ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN    351 - 420
DGAIASMMINKEDELRTVLLEQ                                                    421 - 442
//

Text Mined References (13)

PMID Year Title