Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
Funding $119,765.75
PubMed Score 6.60
PubTator Score 4.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q4G0N4 B5MC93 Q6UTX5 Q96NM0
Symbols DECRD
MNADK
NADKD1
C5orf33

Gene

 Grant Application (2)

Gene RIF (3)

PMID Text
24847004 An autosomal recessive defect in NADK2 causes mitochondrial NADPH deficiency with secondary deficiencies in several mitochondrial processes including polyunsaturated fatty acid oxidation and lysine degradation.
23616928 MNADK is localized to mitochondria in Hep G2 cells, and a recombinant MNADK showed NAD kinase activity. MNADK is abundant in mitochondrion-rich tissues, such as liver. MNADK expression was suppressed in human liver tumors. Identification of MNADK immediately suggests a model in which NADK and MNADK are responsible for de novo synthesis of NADP(+) in cytosol and mitochondria, respectively.
23212377 exhibits NAD kinase activity, utilizing ATP or inorganic polyphosphate, and is localized in mitochondria of HEK293A cells

AA Sequence

MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGSRADGGFRPSR      1 - 70
VVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTKNVEHIIDSLRNEGIEVRLVK     71 - 140
RREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIGVNTDPERSEGHLCLPVRYTHSFPEALQKFY    141 - 210
RGEFRWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFI    211 - 280
GESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNR    281 - 350
ELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN    351 - 420
DGAIASMMINKEDELRTVLLEQ                                                    421 - 442
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24847004 2014 Mitochondrial NADP(H) deficiency due to a mutation in NADK2 causes dienoyl-CoA reductase deficiency with hyperlysinemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23616928 2013 MNADK, a novel liver-enriched mitochondrion-localized NAD kinase.
23212377 2012 Identification and characterization of a human mitochondrial NAD kinase.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...