Property Summary

NCBI Gene PubMed Count 6
PubMed Score 30.89
PubTator Score 2.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.438 5.1e-09
Astrocytoma, Pilocytic -1.100 9.8e-04
cystic fibrosis -1.419 3.8e-05
interstitial cystitis 1.600 1.2e-02
oligodendroglioma -1.200 1.1e-02
ovarian cancer 2.200 1.0e-08
posterior fossa group B ependymoma -1.300 3.9e-06
primitive neuroectodermal tumor -1.100 2.4e-02
psoriasis 1.100 3.4e-11
subependymal giant cell astrocytoma -1.545 3.9e-02

Synonym

Accession Q4G0M1 W8S2M9
Symbols CTRP15
FAM132B
C1QTNF15

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MAPARRPAGARLLLVYAGLLAAAAAGLGSPEPGAPSRSRARREPPPGNELPRGPGESRAGPAARPPEPTA      1 - 70
ERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGPPGPPGPQGPPGPIIPPEALLKEFQLLL     71 - 140
KGAVRQRERAEPEPCTCGPAGPVAASLAPVSATAGEDDDDVVGDVLALLAAPLAPGPRAPRVEAAFLCRL    141 - 210
RRDALVERRALHELGVYYLPDAEGAFRRGPGLNLTSGQYRAPVAGFYALAATLHVALGEPPRRGPPRPRD    211 - 280
HLRLLICIQSRCQRNASLEAIMGLESSSELFTISVNGVLYLQMGQWTSVFLDNASGCSLTVRSGSHFSAV    281 - 350
LLGV                                                                      351 - 354
//

Text Mined References (9)

PMID Year Title