Property Summary

NCBI Gene PubMed Count 5
Grant Count 6
R01 Count 4
Funding $373,829.98
PubMed Score 23.45
PubTator Score 2.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma -1.200 0.011
cystic fibrosis -1.419 0.000
primitive neuroectodermal tumor -1.100 0.024
acute quadriplegic myopathy 1.438 0.000
interstitial cystitis 1.600 0.012
pilocytic astrocytoma -1.100 0.001
posterior fossa group B ependymoma -1.300 0.000
subependymal giant cell astrocytoma -1.545 0.039
ovarian cancer 2.200 0.000
psoriasis 1.100 0.000

Gene RIF (2)

PMID Text
26978524 In hemodialysis patients DA and CERA increased levels of ERFE that regulated hepcidin 25 and led to iron mobilization from body stores during erythropoiesis.
22351773 Myonectin links skeletal muscle to lipid homeostasis in liver and adipose tissue in response to alterations in energy state, revealing a novel myonectin-mediated metabolic circuit.

AA Sequence

MAPARRPAGARLLLVYAGLLAAAAAGLGSPEPGAPSRSRARREPPPGNELPRGPGESRAGPAARPPEPTA      1 - 70
ERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGPPGPPGPQGPPGPIIPPEALLKEFQLLL     71 - 140
KGAVRQRERAEPEPCTCGPAGPVAASLAPVSATAGEDDDDVVGDVLALLAAPLAPGPRAPRVEAAFLCRL    141 - 210
RRDALVERRALHELGVYYLPDAEGAFRRGPGLNLTSGQYRAPVAGFYALAATLHVALGEPPRRGPPRPRD    211 - 280
HLRLLICIQSRCQRNASLEAIMGLESSSELFTISVNGVLYLQMGQWTSVFLDNASGCSLTVRSGSHFSAV    281 - 350
LLGV                                                                      351 - 354
//

Text Mined References (8)

PMID Year Title
26978524 2016 Associations among Erythroferrone and Biomarkers of Erythropoiesis and Iron Metabolism, and Treatment with Long-Term Erythropoiesis-Stimulating Agents in Patients on Hemodialysis.
26322167 2015 Is erythroferrone finally the long sought-after systemic erythroid regulator of iron?
24880340 2014 Identification of erythroferrone as an erythroid regulator of iron metabolism.
22351773 2012 Myonectin (CTRP15), a novel myokine that links skeletal muscle to systemic lipid homeostasis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.