Property Summary

NCBI Gene PubMed Count 26
Grant Count 2
R01 Count 2
Funding $146,300
PubMed Score 12.99
PubTator Score 17.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.400 0.003
ependymoma 1.500 0.007
oligodendroglioma 1.300 0.027
group 3 medulloblastoma 1.200 0.002
primitive neuroectodermal tumor 1.400 0.000
adult high grade glioma 1.200 0.012
Pick disease 1.100 0.000
progressive supranuclear palsy -1.600 0.005
ovarian cancer -1.600 0.000

Synonym

Accession Q4G0J3 B2ZHN6 Q3B7A9 Q9P1S7 Q9Y3Z8
Symbols ALAZS
PIP7S
HDCMA18P

Gene

 Grant Application (2)

PDB

4WKR  

 GO Process (1)

Gene RIF (33)

PMID Text
25863285 protein HEXIM with 7SKsnRNP complex comprising the non-coding RNA 7SK and proteins MePCE and LARP7.
25753663 results suggest that LARP7 uses both its N- and C-terminal domains to stabilize 7SK in a closed structure, which forms by joining conserved sequences at the 5'-end with the foot of the 3' hairpin and has thus functional implications
25731772 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
25731772 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
25731772 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
25053741 LARP7 suppresses P-TEFb activity to inhibit breast cancer progression and metastasis.
24607481 LARP7 is most likely recruited to the HIV-1 promoter in the presence of hnRNP A1.
24367103 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
24367103 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
24316072 A La-related protein, LARP7, is associated with P-TEFb, HEXIM1/2, MEPCE, and 7SK RNA in a large stable complex form. Knockdown of LARP7 decreases the steady-state level of 7SK, but increases free P-TEFb and enhances Tat-mediated transcription
More...

AA Sequence

METESGNQEKVMEEESTEKKKEVEKKKRSRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVD      1 - 70
ISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW     71 - 140
IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIP    141 - 210
ALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRD    211 - 280
RVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKENRDIEISTEEEKDTGDLKDS    281 - 350
SLLKTKRKHKKKHKERHKMGEEVIPLRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSG    351 - 420
VPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGD    421 - 490
TECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITK    491 - 560
AEKIRLAKTQQASKHIRFSEYD                                                    561 - 582
//

Text Mined References (42)

PMID Year Title
25863285 2015 Intermolecular recognition of the non-coding RNA 7SK and HEXIM protein in perspective.
25753663 2015 Structural insight into the mechanism of stabilization of the 7SK small nuclear RNA by LARP7.
25053741 2014 LARP7 suppresses P-TEFb activity to inhibit breast cancer progression and metastasis.
24607481 2014 7SK small nuclear ribonucleoprotein complex is recruited to the HIV-1 promoter via short viral transcripts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23887937 2013 Conservation of RNA chaperone activity of the human La-related proteins 4, 6 and 7.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23340209 Mediator MED23 regulates basal transcription in vivo via an interaction with P-TEFb.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...