Property Summary

NCBI Gene PubMed Count 31
PubMed Score 13.81
PubTator Score 17.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.200 1.2e-02
astrocytic glioma 1.400 2.5e-03
ependymoma 1.500 7.4e-03
group 3 medulloblastoma 1.200 1.5e-03
oligodendroglioma 1.300 2.7e-02
ovarian cancer -1.600 4.5e-08
Pick disease 1.100 4.5e-05
primitive neuroectodermal tumor 1.400 4.1e-04
progressive supranuclear palsy -1.600 5.3e-03

 GO Function (1)

 GO Process (1)

Gene RIF (27)

AA Sequence

METESGNQEKVMEEESTEKKKEVEKKKRSRVKQVLADIAKQVDFWFGDANLHKDRFLREQIEKSRDGYVD      1 - 70
ISLLVSFNKMKKLTTDGKLIARALRSSAVVELDLEGTRIRRKKPLGERPKDEDERTVYVELLPKNVNHSW     71 - 140
IERVFGKCGNVVYISIPHYKSTGDPKGFAFVEFETKEQAAKAIEFLNNPPEEAPRKPGIFPKTVKNKPIP    141 - 210
ALRVVEEKKKKKKKKGRMKKEDNIQAKEENMDTSNTSISKMKRSRPTSEGSDIESTEPQKQCSKKKKKRD    211 - 280
RVEASSLPEVRTGKRKRSSSEDAESLAPRSKVKKIIQKDIIKEASEASKENRDIEISTEEEKDTGDLKDS    281 - 350
SLLKTKRKHKKKHKERHKMGEEVIPLRVLSKSEWMDLKKEYLALQKASMASLKKTISQIKSESEMETDSG    351 - 420
VPQNTGMKNEKTANREECRTQEKVNATGPQFVSGVIVKIISTEPLPGRKQVRDTLAAISEVLYVDLLEGD    421 - 490
TECHARFKTPEDAQAVINAYTEINKKHCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITK    491 - 560
AEKIRLAKTQQASKHIRFSEYD                                                    561 - 582
//

Text Mined References (48)

PMID Year Title