Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 4.9e-02

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 2.100 4.9e-02

Synonym

Accession Q4G0I0 Q96RZ0
Symbols URLC5
gs103
CCSMST1

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

MNRVLCAPAAGAVRALRLIGWASRSLHPLPGSRDRAHPAAEEEDDPDRPIEFSSSKANPHRWSVGHTMGK      1 - 70
GHQRPWWKVLPLSCFLVALIIWCYLREESEADQWLRQVWGEVPEPSDRSEEPETPAAYRART             71 - 132
//

Text Mined References (3)

PMID Year Title