Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.9e-04
glioblastoma 1.300 3.7e-05
medulloblastoma, large-cell 1.900 1.5e-04
ovarian cancer 1.600 1.5e-09
psoriasis -1.500 7.0e-24

AA Sequence

MRVTSATCALLLALICSVQLGDACLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANV      1 - 70
SVTERFAHSVVIKKILQSNDCIEAAF                                                 71 - 96
//

Text Mined References (4)

PMID Year Title