Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 6.96485645637299E-24
ovarian cancer 8492 1.45828069139095E-9
glioblastoma 5572 3.68547608322824E-5
medulloblastoma, large-cell 6234 1.52728045190849E-4
atypical teratoid / rhabdoid tumor 4369 4.91418322049247E-4

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.900 0.000
ovarian cancer 1.600 0.000
psoriasis -1.500 0.000

AA Sequence

MRVTSATCALLLALICSVQLGDACLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANV      1 - 70
SVTERFAHSVVIKKILQSNDCIEAAF                                                 71 - 96
//

Text Mined References (4)

PMID Year Title
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.