Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.8e-03

Expression

Synonym

Accession Q4G0G2
Symbols C3orf47

Gene

 Compartment GO Term (0)

AA Sequence

MGWEQETQKSRPWNQVEGRQPGHDPEQDTCSTSPFAMSKSSLRPPKKLMPCASCTAAEPDGFPWLCYSHS      1 - 70
WKCCLTESSGHPGRMDVVYPLLYRWGN                                                71 - 97
//

Text Mined References (6)

PMID Year Title