Property Summary

NCBI Gene PubMed Count 18
PubMed Score 13.44
PubTator Score 10.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 2.28423694668678E-10
sonic hedgehog group medulloblastoma 1482 6.10110751448733E-8
Amyotrophic Lateral Sclerosis 432 9.30937372221002E-8
Breast cancer 3099 1.88831531743253E-7
ovarian cancer 8492 3.00737471149874E-6
acute quadriplegic myopathy 1157 6.20960253283851E-6
hepatocellular carcinoma 550 8.4580811964614E-6
Pick disease 1893 2.75543083218569E-5
osteosarcoma 7933 3.54076591090523E-5
tuberculosis and treatment for 6 months 686 8.51999882072842E-5
atypical teratoid / rhabdoid tumor 4369 2.44926985163169E-4
gastric cancer 436 0.00105237957700756
glioblastoma 5572 0.00112085163290949
primitive neuroectodermal tumor 3031 0.00288178767295899
Waldenstrons macroglobulinemia 765 0.0196141643810121
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0224730533387781
spina bifida 1064 0.043037378970094

Expression

Synonym

Accession Q4FZB7 B7WNX7 Q3SX56 Q4V775 Q6P150 Q96E44 Q9BUL0 Q9H022 Q9H2K3 Q9NXV3 Q9Y393
Symbols CGI85
CGI-85
SUV420H1

Gene

PDB

3S8P  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
C. elegans EggNOG Inparanoid

Gene RIF (8)

PMID Text
26586479 overexpression of SUV420H1 may result in activation of the ERK signaling pathway
26235986 Strong statistical evidence for a causal role of SUV420H1 in autism.
24396869 The crystal structure of SUV420H1 was used to characterize substrate selectivity and product specificity.
23720823 This study suggests a novel role of FRG1 as epigenetic regulator of muscle differentiation and indicates that Suv4-20h1 has a gene-specific function in myogenesis.
21206904 SUV420H1 and SUV420H2 isoforms have different in their cellular localization and effects on myogenic differentiation
19074285 dissect the GRIP1:Suv4-20h1 interaction in vitro and in vivo and examine its potential involvement in hormone-dependent transcriptional regulation by GR
18296440 The data indicate that Suv4-20 generates nearly ubiquitous dimethylation that facilitates the DNA damage response and selective trimethylation that is involved in heterochromatin formation.[Suv4-20]
18187620 Knockdown of suppressor of variegation 4-20 homolog 1 (SUV420H1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MKWLGESKIMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTLKAGKNAVERRSNRCNGNSGFEGQSRYVPSS      1 - 70
GMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFSHNNPVRFRPIKGRQEELKEV     71 - 140
IERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKEHVFIYLRMFATDSGFEILPCNRYSSEQNGA    141 - 210
KIVATKEWKRNDKIELLVGCIAELSEIEENMLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCK    211 - 280
FVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYG    281 - 350
LRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSNRKSSVGVKKNSKSRTLTRQSMSRIPA    351 - 420
SSNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEQKNASRKLEMGNLVLKEPKVVLYKNLPI    421 - 490
KKDKEPEGPAQAAVASGCLTRHAAREHRQNPVRGAHSQGESSPCTYITRRSVRTRTNLKEASDIKLEPNT    491 - 560
LNGYKSSVTEPCPDSGEQLQPAPVLQEEELAHETAQKGEAKCHKSDTGMSKKKSRQGKLVKQFAKIEEST    561 - 630
PVHDSPGKDDAVPDLMGPHSDQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRI    631 - 700
TRYDAQLILENNSGIPKLTLRRRHDSSSKTNDQENDGMNSSKISIKLSKDHDNDNNLYVAKLNNGFNSGS    701 - 770
GSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESRMEVDDYSQYEEESTDDSSSSEGDEEEDD    771 - 840
YDDDFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA                             841 - 885
//

Text Mined References (22)

PMID Year Title
26586479 2015 SUV420H1 enhances the phosphorylation and transcription of ERK1 in cancer cells.
26235986 2015 Incorporating Functional Information in Tests of Excess De Novo Mutational Load.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24396869 2013 Crystal structures of the human histone H4K20 methyltransferases SUV420H1 and SUV420H2.
23720823 2013 FSHD muscular dystrophy region gene 1 binds Suv4-20h1 histone methyltransferase and impairs myogenesis.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21206904 2010 Comparative analyses of SUV420H1 isoforms and SUV420H2 reveal differences in their cellular localization and effects on myogenic differentiation.
19074285 2008 GRIP1-associated SET-domain methyltransferase in glucocorticoid receptor target gene expression.
18296440 2008 Preferential dimethylation of histone H4 lysine 20 by Suv4-20.
More...