Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.67
PubTator Score 4.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma -1.600 0.000
psoriasis -1.100 0.000
glioblastoma -2.000 0.000
osteosarcoma -1.115 0.001
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.500 0.000
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -1.400 0.000

Gene RIF (4)

PMID Text
21821951 The elevated expression of the Hmat-Xa gene (GTDC1) might serve as a candidate marker for colon adenocarcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826048 Observational study of gene-disease association. (HuGE Navigator)
15068588 relatively high expression level in the adult lung, spleen, testis, and peripheral blood leukocyte.

AA Sequence

MSILIIEAFYGGSHKQLVDLLQEELGDCVVYTLPAKKWHWRARTSALYFSQTIPISEHYRTLFASSVLNL      1 - 70
TELAALRPDLGKLKKILYFHENQLIYPVKKCQERDFQYGYNQILSCLVADVVVFNSVFNMESFLTSMGKF     71 - 140
MKLIPDHRPKDLESIIRPKCQVIYFPIRFPDVSRFMPKHKTTHLKKMLGLKGNGGAVLSMALPFQPEQRD    141 - 210
SEDLLKNFNSECDTHCGLDTARQEYLGNSLRQESDLKKSTSSDNSSSHHGENKQNLTVDPCDILGGVDNQ    211 - 280
QRLLHIVWPHRWEHDKDPESFFKVLMHLKDLGLNFHVSVLGETFTDVPDIFSEAKKALGSSVLHWGYLPS    281 - 350
KDDYFQVLCMADVVISTAKHEFFGVAMLEAVYCGCYPLCPKDLVYPEIFPAEYLYSTPEQLSKRLQNFCK    351 - 420
RPDIIRKHLYKGEIAPFSWAALHGKFRSLLTTEPREDL                                    421 - 458
//

Text Mined References (10)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21821951 2011 Remarkable expression in the colon adenocarcinoma of Hmat-Xa, a human mannosyltransferase-like gene, that is homologous to drosophila gene GC15914.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19826048 2009 Candidate gene association study of esophageal squamous cell carcinoma in a high-risk region in Iran.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15068588 2004 Cloning and expression of human GTDC1 gene (glycosyltransferase-like domain containing 1) from human fetal library.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.