Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQTVNTLLFFHL      1 - 70
ILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLSAIGLDRYLLTLHPVWSQQHR     71 - 140
TPRWASSIVLGVWISAAALSIPYLIFRETHHDRKGKVTCQNNYAVSTNWESKEMQASRQWIHVACFISRF    141 - 210
LLGFLLPFFIIIFCYERVASKVKERSLFKSSKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELT    211 - 280
LILTVLTTSFNTIFSPTLYLFVGENFKKVFKKSILALFESTFSEDSSVERTQT                     281 - 333
//

Text Mined References (3)

PMID Year Title