Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
20399748 These data indicate an important role of GPR33 function in innate immunity which became dispensable during human evolution most likely due to past or balancing selection.
15987686 Cloning and analysis of more than 120 mammalian GPR33 orthologs from 16 of 18 eutherian orders revealed an inactivation of this chemoattractant GPCR not only in humans, but also in several great ape and rodent species.

AA Sequence

MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQTVNTLLFFHL      1 - 70
ILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLSAIGLDRYLLTLHPVWSQQHR     71 - 140
TPRWASSIVLGVWISAAALSIPYLIFRETHHDRKGKVTCQNNYAVSTNWESKEMQASRQWIHVACFISRF    141 - 210
LLGFLLPFFIIIFCYERVASKVKERSLFKSSKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELT    211 - 280
LILTVLTTSFNTIFSPTLYLFVGENFKKVFKKSILALFESTFSEDSSVERTQT                     281 - 333
//

Text Mined References (3)

PMID Year Title
20399748 2010 Involvement of the chemokine-like receptor GPR33 in innate immunity.
15987686 2005 The rise and fall of the chemoattractant receptor GPR33.
9653656 1998 Cloning genes encoding receptors related to chemoattractant receptors.