Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.14
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.54711929274615E-4
osteosarcoma 7933 0.00189917635056421
Disease Target Count Z-score Confidence
Menkes disease 20 3.612 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.502 0.002
ovarian cancer -1.100 0.000

Synonym

Accession Q49B96 A4FTX0 hCOX19
Symbols

Gene

  Ortholog (9)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae EggNOG Inparanoid

Gene RIF (2)

PMID Text
23345593 COX19 is necessary for the transduction of a SCO1-dependent mitochondrial redox signal that regulates ATP7A-mediated cellular copper efflux.
16212937 Both hCox18p and hCox19p present significant amino acid identity with the corresponding yeast polypeptides and reveal highly conserved functional domains.

AA Sequence

MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ      1 - 70
EPLEKLGFGDLTSGKSEAKK                                                       71 - 90
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23345593 2013 COX19 mediates the transduction of a mitochondrial redox signal from SCO1 that regulates ATP7A-mediated cellular copper efflux.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16212937 2005 hCOX18 and hCOX19: two human genes involved in cytochrome c oxidase assembly.
15596615 2004 Studies of COX16, COX19, and PET191 in human cytochrome-c oxidase deficiency.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...