Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $129,206.12
PubMed Score 8.14
PubTator Score 4.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.502 0.002
ovarian cancer -1.100 0.000

Synonym

Accession Q49B96 A4FTX0 hCOX19
Symbols

Gene

Gene RIF (2)

PMID Text
23345593 COX19 is necessary for the transduction of a SCO1-dependent mitochondrial redox signal that regulates ATP7A-mediated cellular copper efflux.
16212937 Both hCox18p and hCox19p present significant amino acid identity with the corresponding yeast polypeptides and reveal highly conserved functional domains.

AA Sequence

MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQ      1 - 70
EPLEKLGFGDLTSGKSEAKK                                                       71 - 90
//

Text Mined References (12)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23897914 2013 A genome-wide association study (GWAS) for bronchopulmonary dysplasia.
23345593 2013 COX19 mediates the transduction of a mitochondrial redox signal from SCO1 that regulates ATP7A-mediated cellular copper efflux.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16212937 2005 hCOX18 and hCOX19: two human genes involved in cytochrome c oxidase assembly.
15596615 2004 Studies of COX16, COX19, and PET191 in human cytochrome-c oxidase deficiency.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...