Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q49AS3 Q5JVP0
Symbols C9orf29

 Compartment GO Term (0)

AA Sequence

MNRNILEEMLQYLLIDWIVGDQFEIQLNQQLWSLIPNNDVRRLVSHVIRTLKTDCTETHLQLACAKLISR      1 - 70
TGLLMKLLSEQQELRTVSMTAWKPRMNRKSRSRMRS                                       71 - 106
//

Text Mined References (3)

PMID Year Title