Property Summary

NCBI Gene PubMed Count 75
Grant Count 74
R01 Count 56
Funding $12,587,522.45
PubMed Score 215.87
PubTator Score 83.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q49AN0 B4DH32 B4DZD6 O75148 Q8IV71
Symbols HCRY2
PHLL2

Gene

Gene RIF (53)

PMID Text
26966073 Given the distinct characteristics of the C-terminal tails of the CRY1 and CRY2 proteins, our study addresses a long-standing hypothesis that the ratio of these two CRY molecules affects the clock period.
26768731 Altered CRY1 and CRY2 expression patterns and the interplay with the genetic landscape in colon cancer cells may underlie phenotypic divergence.
26726810 data may point to CRY2 as a novel switch in hepatic fuel metabolism promoting triglyceride storage and, concomitantly, limiting glucose production
25855785 Data indicate that cryptochrome 2 (CRY2) knockdown leads to chemosensitivity of colorectal cancer cell lines.
25740058 These findings suggest that the core circadian gene CRY2 is associated with breast cancer progression and prognosis, and that knockdown of CRY2 causes the epigenetic dysregulation of genes involved in cancer-relevant pathways
25707907 these observations suggest a biologically plausible season-dependent association between SNPs at CRY1, CRY2 and MTNR1B and glucose homeostasis.
25391456 CRY1 and CRY2 variants showed nominal association with the metabolic syndrome components, hypertension and triglyceride levels.
25365257 CRY2 and REV-ERB ALPHA as the clock genes upregulated in obesity during the 24 h period and that REV-ERB ALPHA is an important gene associated with MS.
24335056 Our data indicate that variants in the circadian-related genes CRY2 and MTNR1B may affect long-term changes in energy expenditure, and dietary fat intake may modify the genetic effects.
24099037 CRY2 genetic variants associate with the depressive episodes in a range of mood disorder; CRY2 is hypothesized to a key to the resetting of clocks throughout and play a leading role in the antidepressant effect of total sleep deprivation
More...

AA Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINR      1 - 70
WRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAG     71 - 140
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYG    141 - 210
VPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLS    211 - 280
CRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA    281 - 350
EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS    351 - 420
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIV    421 - 490
NHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPK    491 - 560
RKLEAAEEPPGEELSKRARVAELPTPELPSKDA                                         561 - 593
//

Text Mined References (81)

PMID Year Title
26966073 2016 The ratio of intracellular CRY proteins determines the clock period length.
26768731 2016 Deregulated expression of cryptochrome genes in human colorectal cancer.
26726810 2016 Glucose-Raising Polymorphisms in the Human Clock Gene Cryptochrome 2 (CRY2) Affect Hepatic Lipid Content.
26569474 2016 A magnetic protein biocompass.
25855785 2015 Circadian Clock Gene CRY2 Degradation Is Involved in Chemoresistance of Colorectal Cancer.
25740058 2015 The circadian gene CRY2 is associated with breast cancer aggressiveness possibly via epigenomic modifications.
25707907 2015 Season-dependent associations of circadian rhythm-regulating loci (CRY1, CRY2 and MTNR1B) and glucose homeostasis: the GLACIER Study.
25416956 2014 A proteome-scale map of the human interactome network.
25391456 2015 CRY1, CRY2 and PRKCDBP genetic variants in metabolic syndrome.
25365257 2014 Altered clock gene expression in obese visceral adipose tissue is associated with metabolic syndrome.
More...