Property Summary

NCBI Gene PubMed Count 83
PubMed Score 232.34
PubTator Score 83.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.900 2.2e-08
Astrocytoma, Pilocytic -1.800 4.0e-13
atypical teratoid / rhabdoid tumor -1.800 3.9e-11
cutaneous lupus erythematosus -1.300 5.2e-04
ductal carcinoma in situ -1.100 1.7e-03
ependymoma -1.300 7.7e-12
glioblastoma -1.900 1.2e-15
group 3 medulloblastoma -1.600 1.9e-06
inflammatory breast cancer -1.100 4.1e-03
invasive ductal carcinoma -1.400 2.8e-03
lung adenocarcinoma -1.400 7.1e-10
lung cancer -1.200 1.4e-03
medulloblastoma, large-cell -1.900 4.0e-07
non primary Sjogren syndrome sicca 1.200 3.2e-02
non-small cell lung cancer -1.361 3.5e-26
primitive neuroectodermal tumor -1.400 8.6e-06
psoriasis -1.300 1.8e-09
spina bifida -1.106 4.0e-02
subependymal giant cell astrocytoma -1.227 8.1e-03

Protein-protein Interaction (8)

Gene RIF (60)

AA Sequence

MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINR      1 - 70
WRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAG     71 - 140
VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYG    141 - 210
VPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLS    211 - 280
CRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWA    281 - 350
EGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS    351 - 420
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIV    421 - 490
NHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPK    491 - 560
RKLEAAEEPPGEELSKRARVAELPTPELPSKDA                                         561 - 593
//

Text Mined References (88)

PMID Year Title