Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.40
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
primitive neuroectodermal tumor 3031 7.37351884648671E-5
osteosarcoma 7933 1.02170045761518E-4
oligodendroglioma 2849 0.00345392895310159
astrocytic glioma 2241 0.00779694474104258
ependymoma 2514 0.0103367384438979

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 0.008
ependymoma 1.100 0.010
oligodendroglioma 1.700 0.003
osteosarcoma -1.141 0.000
primitive neuroectodermal tumor 1.100 0.000

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA Inparanoid

 Compartment GO Term (2)

Gene RIF (1)

PMID Text
21790010 A fragment of the CCDC142-TTC31 intergenic region was cloned; this fragment functions as bidirectional promoter.

AA Sequence

MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGLHRIHVDGSSG      1 - 70
RLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSL     71 - 140
LQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDE    141 - 210
SPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPP    211 - 280
REERPQQSPKVQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHE    281 - 350
RLGQPAWALADAQVALTLRPGWPRGLFRLGKALMGLQRFREAAAVFQETLRGGSQPDAARELRSCLLHLT    351 - 420
LQGQRGGICAPPLSPGALQPLPHAELAPSGLPSLRCPRSTALRSPGLSPLLHYPSCHRSHPNQPLSQTQS    421 - 490
RRPHPLKPQDPSKGWDILGLGLQHLSQAR                                             491 - 519
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21790010 [Novel bidirectional promoter from human genome].
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.