Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.50
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
primitive neuroectodermal tumor 3035 7.4e-05
osteosarcoma 7950 1.0e-04
oligodendroglioma 2850 3.5e-03
astrocytic glioma 2597 7.8e-03
ependymoma 4679 1.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 7.8e-03
ependymoma 1.100 1.0e-02
oligodendroglioma 1.700 3.5e-03
osteosarcoma -1.141 1.0e-04
primitive neuroectodermal tumor 1.100 7.4e-05

Gene RIF (1)

AA Sequence

MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGLHRIHVDGSSG      1 - 70
RLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSL     71 - 140
LQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDE    141 - 210
SPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPP    211 - 280
REERPQQSPKVQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHE    281 - 350
RLGQPAWALADAQVALTLRPGWPRGLFRLGKALMGLQRFREAAAVFQETLRGGSQPDAARELRSCLLHLT    351 - 420
LQGQRGGICAPPLSPGALQPLPHAELAPSGLPSLRCPRSTALRSPGLSPLLHYPSCHRSHPNQPLSQTQS    421 - 490
RRPHPLKPQDPSKGWDILGLGLQHLSQAR                                             491 - 519
//

Text Mined References (8)

PMID Year Title