Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.40
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma 1.100 0.008
ependymoma 1.100 0.010
oligodendroglioma 1.700 0.003
osteosarcoma -1.141 0.000
primitive neuroectodermal tumor 1.100 0.000

Gene RIF (1)

PMID Text
21790010 A fragment of the CCDC142-TTC31 intergenic region was cloned; this fragment functions as bidirectional promoter.

AA Sequence

MAPIPKTVGRIKLDCSLRPSCPLEVAAAPKLCKEFGPEDYGEEDIVDFLRRLVESDPQGLHRIHVDGSSG      1 - 70
RLQLWHHDYLLGHLDDEGKSTGQSDRGKGAEGLGTYCGLRKSFLYPPQESEPCPQSPSASATFPSVSDSL     71 - 140
LQVAMPQKLLVTEEEANRLAEELVAEEERMKQKAEKKRLKKKRQKERKRQERLEQYCGEPKASTTSDGDE    141 - 210
SPPSSPGNPVQGQCGEEEDSLDLSSTFVSLALRKVGDWPLSARREKGLNQEPQGRGLALQKMGQEEESPP    211 - 280
REERPQQSPKVQASPGLLAAALQQSQELAKLGTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHE    281 - 350
RLGQPAWALADAQVALTLRPGWPRGLFRLGKALMGLQRFREAAAVFQETLRGGSQPDAARELRSCLLHLT    351 - 420
LQGQRGGICAPPLSPGALQPLPHAELAPSGLPSLRCPRSTALRSPGLSPLLHYPSCHRSHPNQPLSQTQS    421 - 490
RRPHPLKPQDPSKGWDILGLGLQHLSQAR                                             491 - 519
//

Text Mined References (8)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21790010 [Novel bidirectional promoter from human genome].
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.