Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.58
PubTator Score 6.06

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.6e-07
Pick disease 1894 2.3e-04
osteosarcoma 7950 7.7e-04
group 3 medulloblastoma 4104 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5


  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.100 3.4e-02
osteosarcoma -1.493 7.7e-04
ovarian cancer -1.300 2.6e-07
Pick disease -1.300 2.3e-04

Gene RIF (5)

AA Sequence

NLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE                                       351 - 385

Text Mined References (15)

PMID Year Title