Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.58
PubTator Score 6.06

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.59679384954449E-7
osteosarcoma 7933 2.63003125765696E-6
Pick disease 1893 2.28752594651675E-4
group 3 medulloblastoma 2254 0.0340767493278512


  Differential Expression (4)

Disease log2 FC p
osteosarcoma -2.049 0.000
group 3 medulloblastoma 1.100 0.034
Pick disease -1.300 0.000
ovarian cancer -1.300 0.000


Accession Q49AM1 Q53HM2 Q9H4L6 Q9H7Y9
Symbols mTERFL


  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (5)

26826381 These findings demonstrate that MTERF2 contributes to MPP(+)-induced mitochondrial disruption and cell damage.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20577816 MTERFD1 and MTERFD3 have a role in impairing the completion of mitochondrial DNA replication
20430012 MTERF-domain of human MTERF3 forms a half-doughnut-shaped right-handed superhelix.
16226716 mTERFL is a novel mTERF family member and a serum-inhibitory factor probably participating in the regulation of cell growth

AA Sequence

NLNGSKKEFEANFGKIQAKKVRPLFNPVAPLNVEE                                       351 - 385

Text Mined References (14)

PMID Year Title
26826381 2016 MTERF2 contributes to MPP(+)-induced mitochondrial dysfunction and cell damage.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20577816 2011 Overexpression of MTERFD1 or MTERFD3 impairs the completion of mitochondrial DNA replication.
20430012 2010 Structure of mitochondrial transcription termination factor 3 reveals a novel nucleic acid-binding domain.
19366608 2009 MTERF2 is a nucleoid component in mammalian mitochondria.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16226716 2005 Cloning and functional analysis of human mTERFL encoding a novel mitochondrial transcription termination factor-like protein.
16193327 2005 A family of putative transcription termination factors shared amongst metazoans and plants.