Property Summary

NCBI Gene PubMed Count 12
PubMed Score 113.07
PubTator Score 16.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Cocaine Dependence 51
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 0.8
Disease Target Count Z-score Confidence
Parkinson's disease 392 5.044 2.5

Expression

Gene RIF (9)

AA Sequence

MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISF      1 - 70
CLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLR     71 - 140
KMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL                           141 - 187
//

Text Mined References (15)

PMID Year Title