Property Summary

NCBI Gene PubMed Count 11
Grant Count 15
Funding $3,458,440.96
PubMed Score 94.66
PubTator Score 16.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Parkinson's disease 364 4.783 2.4

Expression

Gene RIF (8)

PMID Text
26149686 showed that CDNF was able to protect dopaminergic neurons against injury caused by alpha-synuclein oligomers. This advises its use against physiological damages caused by alpha-synuclein oligomers
25975173 Results suggest that CDNF treatment selectively enhances long-term memory consolidation
25511018 Expression of CDNF in the substantia nigra has an anti-inflammatory effect on experimental Parkinson's disease.
21320571 Although no CDNF mutations are found in early-onset Parkinson's disease patient samples, a trend towards increased risk for Parkinson's in carriers of the C allele of rs7094179 single nucleotide polymorphism (SNP) is found.
19429035 Study suggests that there is no association between variants in the CDNF gene and cocaine dependence.
19429035 Observational study of gene-disease association. (HuGE Navigator)
19258449 structures of MANF and CDNF were solved; structure explains why MANF and CDNF are bifunctional; neurotrophic activity may reside in the N-terminal domain and ER stress response in the C-terminal domain
17611540 expressed in several tissues; might be beneficial for the treatment of Parkinson's disease

AA Sequence

MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISF      1 - 70
CLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLR     71 - 140
KMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL                           141 - 187
//

Text Mined References (14)

PMID Year Title
26149686 2015 The Solution Structure and Dynamics of Full-length Human Cerebral Dopamine Neurotrophic Factor and Its Neuroprotective Role against ?-Synuclein Oligomers.
25975173 2015 Cerebral dopamine neurotrophic factor improves long-term memory in APP/PS1 transgenic mice modeling Alzheimer's disease as well as in wild-type mice.
25511018 2014 Transient transfection of human CDNF gene reduces the 6-hydroxydopamine-induced neuroinflammation in the rat substantia nigra.
21320571 2011 Analysis of mutations and the association between polymorphisms in the cerebral dopamine neurotrophic factor (CDNF) gene and Parkinson disease.
19429035 2009 Association analysis between polymorphisms in the conserved dopamine neurotrophic factor (CDNF) gene and cocaine dependence.
19258449 2009 The structure of the conserved neurotrophic factors MANF and CDNF explains why they are bifunctional.
18561914 2008 Armet, a UPR-upregulated protein, inhibits cell proliferation and ER stress-induced cell death.
17611540 2007 Novel neurotrophic factor CDNF protects and rescues midbrain dopamine neurons in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
More...