Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.58
PubTator Score 1.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.083 0.007
Multiple myeloma 1.701 0.000
osteosarcoma 1.549 0.000
medulloblastoma, large-cell 1.200 0.000
pancreatic ductal adenocarcinoma liver m... 1.130 0.029
group 3 medulloblastoma 1.100 0.002
ovarian cancer -2.200 0.000
dermatomyositis 1.700 0.000

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of zinc finger, BED-type containing 5 (ZBED5) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MIAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQS      1 - 70
EDKQLQPSVSKKSEGELSRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKKILS     71 - 140
NSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEA    141 - 210
HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDES    211 - 280
ADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVD    281 - 350
GKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMG    351 - 420
AQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLS    421 - 490
MQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAIVQHLRGLRATL    491 - 560
LKYFPVTNDNNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARR    561 - 630
AVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH           631 - 693
//

Text Mined References (12)

PMID Year Title
23533661 2013 ZBED evolution: repeated utilization of DNA transposons as regulators of diverse host functions.
23166581 2012 Comparative analysis of the recently discovered hAT transposon TcBuster in human cells.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...