Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.17
PubTator Score 1.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.700 1.6e-04
group 3 medulloblastoma 1.100 2.1e-03
medulloblastoma, large-cell 1.200 2.9e-05
Multiple myeloma 1.701 5.1e-05
osteosarcoma -1.146 2.0e-03
ovarian cancer -2.200 7.8e-10
pancreatic ductal adenocarcinoma liver m... 1.130 2.9e-02
Waldenstrons macroglobulinemia 1.083 6.7e-03

Synonym

Accession Q49AG3 B2RCC1 Q05D82 Q86WW3 Q9NT24 Q9UBJ4
Symbols Buster1

Gene

  Ortholog (1)

Species Source Disease
Dog OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MIAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQS      1 - 70
EDKQLQPSVSKKSEGELSRVKFISNSNKITFSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKKILS     71 - 140
NSSLAPSKLRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEA    141 - 210
HTIGELLIKPCAKDVVMRMFDEQYSKKIDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDES    211 - 280
ADVSGLAVLLVFVRYRFNKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEWEKCVDVCSDASRAVD    281 - 350
GKIAEAVTLIKYVAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMG    351 - 420
AQHTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLS    421 - 490
MQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINSTVDKDICSAIVQHLRGLRATL    491 - 560
LKYFPVTNDNNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNFSELSLNDFWSSLIQEYPSIARR    561 - 630
AVRVLLPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSNITPNIKRICDKKTQKHCSH           631 - 693
//

Text Mined References (12)

PMID Year Title