Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.03
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 8.7e-06
osteosarcoma 7950 1.1e-04
group 3 medulloblastoma 4104 1.2e-04
primitive neuroectodermal tumor 3035 4.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 8.7e-06
group 3 medulloblastoma 1.500 1.2e-04
osteosarcoma -1.973 1.1e-04
primitive neuroectodermal tumor 1.100 4.5e-03

Gene RIF (2)

AA Sequence

MPQQLLITLPTEASTWVKLQHPKKAVEGAPLWEDVTKMFEGEALLSQDAEDVKTQRESLEDEVTPGLPTA      1 - 70
ESQELLTFKDISIDFTQEEWGQLAPAHQNLYREVMLENYSNLVSVGYQLSKPSVISQLEKGEEPWMAEKE     71 - 140
GPGDPSSDLKSKIETIESTAKSTISQERLYHGIMMESFMRDDIIYSTLRKVSTYDDVLERHQETCMRDVR    141 - 210
QAILTHKKRVQETNKFGENIIVHSNVIIEQRHHKYDTPTKRNTYKLDLINHPTSYIRTKTYECNICEKIF    211 - 280
KQPIHLTEHMRIHTGEKPFRCKECGRAFSQSASLSTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHT    281 - 350
GEKPYVCDKCQKAFSQNISLVQHLRTHSGEKPFTCNECGKTFRQIRHLSEHIRIHTGEKPYACTACCKTF    351 - 420
SHRAYLTHHQRIHTGERPYKCKECGKAFRQRIHLSNHKTVHTGVKAYECNRCGKAYRHDSSFKKHQRHHT    421 - 490
GEKPYECNECGKAFSYNSSLSRHHEIHRRNAFRNKV                                      491 - 526
//

Text Mined References (9)

PMID Year Title