Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.33
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 1.8e-02
Astrocytoma, Pilocytic -1.500 4.9e-05
atypical teratoid / rhabdoid tumor -2.300 1.2e-10
Breast cancer 1.100 3.3e-02
breast carcinoma -1.200 1.2e-03
chronic rhinosinusitis -1.118 5.0e-03
cystic fibrosis and chronic rhinosinusit... -1.528 3.1e-02
ependymoma 1.800 1.1e-03
glioblastoma -1.400 2.7e-06
group 4 medulloblastoma -1.700 6.9e-04
invasive ductal carcinoma -2.100 9.6e-03
lung carcinoma -1.600 4.9e-15
medulloblastoma, large-cell -2.300 2.9e-04
primitive neuroectodermal tumor -1.700 6.4e-03
psoriasis -1.400 4.3e-33
subependymal giant cell astrocytoma 2.163 5.0e-02

Synonym

Accession Q49A92 A8K5X1 G3XAM6 Q8N1X0 Q8N9M7 Q8ND19 Q96Q28
Symbols VEST1
VEST-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

AA Sequence

MASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESE      1 - 70
KSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSLPRSVEHPKWNWRTKPQSRDFDEL     71 - 140
NHILQESKKLGKALENLSRSIAISDELDKETVTFNSSLLRPRVIGEWIGREENDADPLAAEMLQPPIPRS    141 - 210
KNDQWESEDSGSSPAGSLKMEPKNKGLKQQQQQHKKLLAAMLSQDSFESIHSPTPSVTEEDIDNEDDAME    211 - 280
LLEDLNDLRMEGVTTLVPSGSKFNQGRPTYPAEPQAKVTLNICSRCARLQGDNLEERTEESLPILHSPDE    281 - 350
KIPDSFDSLPGTEEALMEEGDEFEKASKLTGPGEASSGVGHSLKNYMEEDESLKQLQVVHQPWILPSDTE    351 - 420
SEGVEAEQEKRSADLLLCVPCSSCPTLVYSGL                                          421 - 452
//

Text Mined References (11)

PMID Year Title