Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.36
PubTator Score 0.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 8.52444222619222E-6
glioblastoma 5572 5.71151800266246E-5
primitive neuroectodermal tumor 3031 3.36927728202665E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.83011926567899E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00115445435214797
adrenocortical carcinoma 1427 0.00133486682115513
ovarian cancer 8492 0.00154175642820162
nasopharyngeal carcinoma 1056 0.00159013507983193
medulloblastoma, large-cell 6234 0.00168873432581193
group 3 medulloblastoma 2254 0.00542504136610045
ependymoma 2514 0.00941011516979737
progressive supranuclear palsy 674 0.0123490457434651
astrocytic glioma 2241 0.0307212204356107
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0329725361408984
oligodendroglioma 2849 0.0443495848110751

Expression

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MKRGIRRDPFRKRKLGGRAKKVREPTAVNSFYREASLPSVWASLRRREMVRSGARPGQVLSSGRHTGPAK      1 - 70
LTNGKKATYLRKIPRFNADSGYSIHSDSESQAETVHGLDGCASLLRDILRNEDSGSETAYLENRSNSRPL     71 - 140
ESKRYGSKKKRHEKHTIPLVVQKETSSSDNKKQIPNEASARSERDTSDLEQNWSLQDHYRMYSPIIYQAL    141 - 210
CEHVQTQMSLMNDLTSKNIPNGIPAVPCHAPSHSESQATPHSSYGLCTSTPVWSLQRPPCPPKVHSEVQT    211 - 280
DGNSQFASQGKTVSATCTDVLRNSFNTSPGVPCSLPKTDISAIPTLQQLGLVNGILPQQGIHKETDLLKC    281 - 350
IQTYLSLFRSHGKETHLDSQTHRSPTQSQPAFLATNEEKCAREQIREATSERKDLNIHVRDTKTVKDVQK    351 - 420
AKNVNKTAEKVRIIKYLLGELKALVAEQEDSEIQRLITEMEACISVLPTVSGNTDIQVEIALAMQPLRSE    421 - 490
NAQLRRQLRILNQQLREQQKTQKPSGAVDCNLELFSLQSLNMSLQNQLEESLKSQELLQSKNEELLKVIE    491 - 560
NQKDENKKFSSIFKDKDQTILENKQQYDIEITRIKIELEEALVNVKSSQFKLETAEKENQILGITLRQRD    561 - 630
AEVTRLRELTRTLQTSMAKLLSDLSVDSARCKPGNNLTKSLLNIHDKQLQHDPAPAHTSIMSYLNKLETN    631 - 700
YSFTHSEPLSTIKNEETIEPDKTYENVLSSRGPQNSNTRGMEEASAPGIISALSKQDSDEGSETMALIED    701 - 770
EHNLDNTIYIPFARSTPEKKSPLSKRLSPQPQIRAATTQLVSNSGLAVSGKENKLCTPVICSSSTKEAED    771 - 840
APEKLSRASDMKDTQLLKKIKEAIGKIPAATKEPEEQTACHGPSGCLSNSLQVKGNTVCDGSVFTSDLMS    841 - 910
DWSISSFSTFTSRDEQDFRNGLAALDANIARLQKSLRTGLLEK                               911 - 953
//

Text Mined References (17)

PMID Year Title
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
25416956 2014 A proteome-scale map of the human interactome network.
24613305 2014 Proximity interactions among centrosome components identify regulators of centriole duplication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...