Property Summary

NCBI Gene PubMed Count 6
PubMed Score 55.85
PubTator Score 9.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Pick disease 1894 2.8e-06
osteosarcoma 7950 1.4e-05
oligodendroglioma 2850 2.0e-03
COPD 118 1.1e-02
ependymoma 4679 1.3e-02
intraductal papillary-mucinous neoplasm (IPMN) 3291 1.6e-02
Gaucher disease type 1 180 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Band keratopathy 5 4.38 2.2
Nasopharynx carcinoma 18 3.492 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
COPD -1.100 1.1e-02
ependymoma 1.100 1.3e-02
Gaucher disease type 1 -1.100 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.6e-02
oligodendroglioma 1.300 2.0e-03
osteosarcoma 1.815 1.4e-05
Pick disease -1.200 2.8e-06

AA Sequence

MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEM      1 - 70
IKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNM     71 - 140
GEGKKRVSSGSSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPV    141 - 210
KDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGS    211 - 280
GIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQG    281 - 350
IRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAM    351 - 420
GKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNIL    421 - 490
QGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH           491 - 553
//

Text Mined References (19)

PMID Year Title