Property Summary

NCBI Gene PubMed Count 6
PubMed Score 51.56
PubTator Score 9.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Pick disease 1893 2.8307986987537E-6
osteosarcoma 7933 1.44231302284395E-5
oligodendroglioma 2849 0.0020298528720832
COPD 116 0.0108979177571265
ependymoma 2514 0.0131343282112336
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.016032790245567
Gaucher disease type 1 171 0.0282435779402021
Disease Target Count Z-score Confidence
Band keratopathy 4 4.402 2.2
Nasopharynx carcinoma 19 3.169 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 0.013
oligodendroglioma 1.300 0.002
osteosarcoma 1.815 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.016
COPD -1.100 0.011
Pick disease -1.200 0.000
Gaucher disease type 1 -1.100 0.028

Synonym

Accession Q49A26 B4DL47 C9JJ40 C9JJ60 Q5U632 Q6P1Q2 Q6V3W7 Q9BTI1 Q9BXK2
Symbols NP60
BM045
HIBDL
N-PAC

Gene

PANTHER Protein Class (2)

PDB

4GUR   4GUS   4GUT   4GUU   4HSU   2UYY  

  Ortholog (10)

Pathway (1)

AA Sequence

MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEM      1 - 70
IKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNM     71 - 140
GEGKKRVSSGSSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPV    141 - 210
KDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGS    211 - 280
GIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQG    281 - 350
IRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAM    351 - 420
GKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAHVTGQSQQTLLDILNQGQLASIFLDQKCQNIL    421 - 490
QGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH           491 - 553
//

Text Mined References (17)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
23260659 2013 LSD2/KDM1B and its cofactor NPAC/GLYR1 endow a structural and molecular model for regulation of H3K4 demethylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...