Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.56
PubTator Score 1.25

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q49A17 Q2L4S6
Symbols GALNT17
GALNACT20
GalNAc-T6L

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
20977886 a novel member of the human ppGalNAc-T family, ppGalNAc-T20, which has high homology with human ppGalNAc-T10 was identified.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MKRKQKRFLQMTLLFTVALIFLPNVGLWSLYKDKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWH      1 - 70
DYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLP     71 - 140
NTSIIIPFHNEGWTSLLRTIHSIINRTPGSLIAEIILVDDFSEREHLKDKLEEYMARFSKVRIVRTKKRE    141 - 210
GLIRTRLLGASMARGEVLTFLDSHCEVNVNWLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMR    211 - 280
GAFDWEMYYKRIPIPPELQRADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWM    281 - 350
CGGEMFDVPCSRVGHIYRKYVPYKVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKE    351 - 420
LRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAANLCVDSKHGATGTELRLDICVKDGSER    421 - 490
TWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQLWGYRKDRTLFHPVSNSCMD    491 - 560
CNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKFNHHANS                                 561 - 601
//

Text Mined References (7)

PMID Year Title
20977886 2010 Identification of a novel human UDP-GalNAc transferase with unique catalytic activity and expression profile.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.