Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.13
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.4e-03
glioblastoma 1.200 1.9e-02
group 4 medulloblastoma 1.900 2.7e-03
medulloblastoma, large-cell 1.300 2.0e-04
osteosarcoma -1.815 2.1e-07
ovarian cancer 1.100 8.6e-04

AA Sequence

MFATSGAVAAGKPYSCSECGKSFCYSSVLLRHERAHGGDGRFRCLECGERCARAADLRAHRRTHAGQTLY      1 - 70
ICSECGQSFRHSGRLDLHLGAHRQRCRTCPCRTCGRRFPHLPALLLHRRRQHLPERPRRCPLCARTFRQS     71 - 140
ALLFHQARAHPLGTTSDPAAPPHRCAQCPRAFRSGAGLRSHARIHVSRSPTRPRVSDAHQCGVCGKCFGK    141 - 210
SSTLTRHLQTHSGEKPFKCPECGKGFLESATLVRHQRTHTGEKPYACGDCGRCFSESSTLLRHRRSHQGE    211 - 280
RPHACATCGKGFGQRSDLVVHQRIHTGEKPFACPECGRRFSDRSDLTKHRRTHTGEKPYRCELCGKRFTC    281 - 350
VSNLNVHRRNHAGHKPHKCPECSKAFSVASKLALHRKTHLGERPAECAECGKCFSHSRSLSQHQRAHTRA    351 - 420
RTAAAVAIQSAVGTALVFEGPAEQEKPGFSVS                                          421 - 452
//

Text Mined References (3)

PMID Year Title